ELFa( 4C4 ( \\;;((CccPۣeȧCȧcȧc$$_DO! "&@00Q_: 0/C\@/ XX@0 6QQO @@( @0 P`D! B00 R hР -L(:cPj=jcmain() returned , p-, LP 0S P) p4 ` ,  0P,00,0p 0 $0D PT0T0S , , p -0P@Lp8`  R  0@ 0 dR -0P@Lp8`  R  0 @ 0 dR/ -L_Œ @x`0 P  'H0!@ 0',0 0` 0 0' M-LM0'XX @X0 , %X 0  ( "('$' ,  pPP( 0"(X )%( 0 0 , 0'(h@(K 0-_02@P L0@ 0'0@-0@  0S  4000$ 4 @4@ -4L0S@440S - L0 -LM40S  3 lH0 ,P6 K 0 Kh699 p-LM@`P3PUOp3e H0 P600 h0 \863 @68963  : 669$92:89H99 Q-L@ 60 6\9h9 -PL4p`V$ 4! ,0 v0 v6s6p6,0 000,  ,  0h(PU@0D PT,0 0,0ꀌ9F:99999 0-0L @P ,00,0 R 0$ 0 00  0 0㹼,00,0 R$ 0 0 00  0   0;00h0h20 p-8P@L@`4 00 00S > S 0 p R  B  h3 000 P3Xp 0 00 39p9@9 0-L@LPT 0( w0( 0hn' p-L@`: ePUP00S`XP ?ip  000PS p 0U 0 0 80P@p0UPp -0LSP 0S" 00 @ = p`Z8:Xo`Z6 @ 3S `V 0@ 0TTPPQ @Po@ ̿00000@TP303k9P060 0 308#83 R 00  [ @l00娺h ; p-L@V みP`dU  0t00PY YR`pp 0-LP@P 0)dTH@ @0aP' 0H@ 0T 0' -LM0` Pp @2.0S3  07P.0  0*0,0K0,0 Khn  KhQ0S 08#808#80KhN  0P00 0S  0P3g4 Kh* -0`10#LP8p@P@ 00 0000  0 0, |0| 004 P偸`0  @ᶹ0@  0)0  h   9 -L M0PSp 0S` K@K ]&PS 03K 3[8#808#83K0` P`h3[8#808#83K 3[8#8<8#83K0@0 4 @K?0K 50T;@T*6 @0S4 000S$ 00~ v 60Ts@T*v0OK000 J,$P000Bl0  PH0@  P0 0 0   h ; p-L@PŶ04`K~ @p -|2L M PRh2   \`0KSP2`0 0 S82004 plPRd0S{ 3/3>1 :`@ 000S3033 T] 囼3dp0p|14 P=303@To3 `3`V㏏H0"S3R1  Ko0 ,pK R$3 00,0K,0K3 f @4  0+@K*K(  8$#t003 P3,00,0POch ;p @ ;r,   0-L M|P@T  B P00 K0H 0@`@^),P)$0 !00 ;9lgt T'0 0  /> p-0LM @+P-` p0 00> `P0 R0C  (P01Ł'B'D'F'H'J'L' 0-LM R7 7 @7 \7 6 6 6 6 x7 7 7 7 7 6 8 48 8 8 6 7 6 8 0P@0!80! 001P @1 P @@P1P @x1 P @`1P @H1  8!0 @P0- @0 P0 000 0 0 0 0P @0 P @l 0`@0 PD D0 @P|T'2'4'6'8':'<'B'D'F'H'L'J' R-L r  p-LMQ@;01  P `# 0!0  0PPV0(B(R`0 01> 0PP9 p+r 00a=C4`#hl 0d+p0S 40< `*  `0:0 T'80'9 p-0L P@p= `  000l2  R` ^L00 S 0PPV@p #=j# -LM8 `x0\2\0 00 H4 ,  82 R 0(K002@ Q@PA  0PTl TM TUR  002@P 0ހPT > $= $= $= $= <> ,> > = 819 $1 40R 1 8 0x|R TU@@ 00@ R0 ,RU0  0 X0@@D0@@40 $00 U 8.:D$T'  -LM4 < /<8 0@P` S @@ T@ h@ > |@ > > > > > @  00 ,0 80A C0R8? (? ,@ ? (? ? 0 , @$@`< p0P00K4@ nN0 0 P!P   K408 <00(K8@04 R7@7@8@0@00 ,@ 0 ,  0 ,  00 ,0  0 , .8: -L`M4@K` 03K/ 3#K #s[Qk Qg 0S2Q l   o2 3K2#K 2[R["[`0 dP h  \03Kh2T3K0[["10!40: R2[ R2KKK 5 Rq Rk 1!>?!DFc l^,Ϡ2cl`P10PdP!0PhPc l0p P@})(K @1   TQ,1 lP  @!@1PPZ@K&$1 %K5K P'V0[@S$T0[.S!Q0[-SN0[SO [S[U[*BR[5.B* 3" 1C 0P [1 1  00 d ["[2[H+)T'[8D$ 'H$:hQ9ȍ9v'N$9܍9 0-LMPp0 0 ,%L0@D0!0@ 9I@09A0 0T' -9L@@, 000 000  0-`3 LR@P D3R *83R W,3R 20RH R3 0R (00CR "2Rg -2Rv 0R- # 0hV0CRt 72RD >0R@|2|@ 0C 0h0CRI T2Ry 0R @2@@00CR0 0R( 0? R1 0h,0CR> 0R1@@00CR 0R1@@0@A=@0 1 01@@0p1@@0`1@@0@0  01@@01 0h0@@0 = 0 0h@0@@0D 0 # >0h. t0 00 0 #P9 C:8<JD#26>B.F4# -MLM1 0 p 000CSp(KBKII D k0T `0S` @ T LpP@VP9 3S; 14K3 R ZM@ 0SSD 0 D B0000 . LP  ."T0 #10C 0P %ZK l20Sp0 pQ= RyP TK[ t >K U8K Q0h"0C4K02K#K t B("(04"43K@QBK0 5[Z90K  5K5Z*K 0ZM @ 0 B"S$[4[Q04KD 0 D B0000 <  ZM@0 BR,DPt 0 P0! 0C0 0 b= RC L%Z0 R 5[TK< 5K06KNK pPt w5[QUp㓫H 0@P,PŬUp  ph$T',9 -MLM#,0@cS000 R 0   9# C #< K#< $0 Kx ̠0Kl0AK APA>K R@0# 80BaZD$ H9T';gfff 6S-LP` 8SA  $p 00Q8  X@#8 4/ 00Q`8X@   #8`4/|@@Dt \T0 R0C  (9T𩝨<ph9L$ -LMp!0 0 @P  <>$ 0QPEuC q 0aR0 ` ( U2 0R" D ( R4 h 0X 60dP?`VPTT0 R0C6 l P0XU<T'9L$ -0L RxPx`x@0 $<< p0Tx 0TinD$  0-@LP@#40 00 @0@0謏9T' p-0L M @RP+ 0`0 P PE8u#KpUt 000\01KP01K01K0K 00PD$T'9  -0LHMp$Kh`KD0 ZK P H(@"(D0#K0K"K0 0H00< 0 04P  ##{ T' ԏ9 -LTMl p _l p@l嗩|?`  R  }  L/0 D8?P  &XF?o*T ; D?TK E0CT >T >Tp0l.-X >T [0CTp 0TE  p0l07X 4X0 X0S  x Ox\  H. 0:0`s(K>T !=T S=T =TlEP  4XX l 6@ x +x x=T K 0CTp 0Tl#P@= R l 62 = R   3=X 0X0)   l= XP#L#<@\   P x ,@N`K@&@@;@4KDK K$K HK l x62 0x,  峻p0X *FP l 6@h `; Rd XPN lvP0pX ljP$\: R 0p   0P*0004K?4K :$K NK kp X )FPX 0 S> 9R  R 0CR : Xp0Xd) Gx9T 0T d9Tl 6 49 R  2,9X 0X <0x9 XPX 0 Sb8T 0Tyl 6 = S @SB 9 l0&8 ~x8T p8T h8T\lԿPp6X X080SLp  X LpX El㵿Po Һp X Xl' FP+X0 \7Q~ 7Q s Q%  Q G0XPXP l 6l~P8 固p X X&EPX.p@X l`Pp 1S  y?X 0p 1X 0XPl 6 l6 l 6068&05 Rp 010   `I,X X0/ 5 XPX0 85R p 101l P4 R; "5X 0X0, 45 R  (5 XPX 0Sm >0T0 p X 0T 00bY`p 0S\X 0 P\ d0 t U t0 `  @h  h t0 0$30 R0S   05 %<0 S  S  7S  nS  0t B02 R B000 C B0 2 R00 h`P000p0\  \EPip0 T0 p0 X 0T 00b S[p 0d  Sd T:0B\0 pVX  xd2X 0X0, 2 X@PIX p0 1 ^2X 0X0, (2 XP/X0 p0!@> Z;pX p0# >! DX U   %P01   0 R 0 4K04K 1$K NK@X0 s 2 0T X 0=j 9ii i7i i i iiii .;T gfff9>##818i8i A i iii88?71B$##-%C, D$T'H0   0 R d0 4K04K !⹸X0 x xp  ! mDx0RW 0RD 0CRL |P6 XD`I1>,0X lX 001007X0 T JX +00-#@? x xP X 00!0X 0S00 XD *1 RAX0 s !0X 0$2X 0000,2Q !0Q@2Q< `2Q4 h2Q, p2Q$ x2QC 2Qy\v2Q' D0CQ >0Ql2Q4 0Qe2 RX 2  ~2  U 3  3 @ 43  0dX0 Z3   33 R 3 XH1>,0? -L`匤9 @09Q<,RX&M @0Ÿ00VK 5KKEKD 0\05K20K5K 0x2x"5K K%K 00D2K05K?5K 00^pl;CK5K]0HA5K 1!5K %KK01!#00 `1PL 0SI P @1@!5K 05K0%K 905K0K5K0)0 Qʀ0KK5K0 2T'.:486 > B>#_#<#0: J-F#(99###D$*DH$! -`L@LtPs@D⃨to q䁟0 ( TbA 8R  #8X PR 8  #8X PR8  #8X 8#8 XJEz' pP 0@R0 ` (  0R  ( R4 h 0X Z𯝨9  0Dh<9 (`<<(L$t9L9 -LMP,0 60  Pqa,0> R6 l 2H R6 l 0X @R6 l 0X 60 w@P R6 l (T0P R6 l ((0P(KL$4xV -L0M`P? QC @3P 43QX Fd0CQd  80;P/ @rR8 p 0X R8 p 0X\ RL8 p 0G|2  0hP (K0S@2.`K0K2K02K$2Q9 0Q0SW2K?2K.`K02K00C SJ, $         0!02K0"K.`K2K 10S9 t10S- S08#[.`KK~H!TK0@20pPK&W?D  K5K0 P@T0 R08#P 0H2K.`K0"K2KD      D$L$T'!,'#((D##. p-LM`80@_PPp440 R0C8 p 0FpL$ -3LM PR@v"0 0!P$ 800P4 娂 0rR8 p (0`P 0R8 p (0S (K`0\ RL8 p 0qF0? SD 1 R 1R 1R 0R d0CR< 0RP P 0AS@Ѓ ؃ (1Q% 0Q0S? .PK2K"Kt0\ 0S40 00 000 .PK2K"KV<8# D$T'L$ #.,'(( -T5LTMLEP4K (5 R5 RF G`P +G1 3G0 0@0@(KDp0p P <C4s2 D@F Q0@00P@ @4 R4 Rw FDppx0KP7[㺖[YG`P +qG1  00C b bh3 R 7[* RQ  RO  RM $[Qt0# 0 0. P= R 6[  2 R 2 RxK P wS dFg0 0S S} S2< @>z<@0 x<MFP D0 Q$[P& JK  DK  6K  0  0D P 0 0@0@SF&`MF꼤[>0P 7[4 AF  xK 0 <0< P .F9 <00 0xK bAM @ 0tEp GP 9 `A= G$0 I CP]8T',8'.#ؐ9999d9đ9 -(3L  9sc @SR2 d 0X R4 h 2X褢b r0R2 d X 0R0 ` ( RP4 h <2Xue 0R" D ( R4 h @0X1 Rf 9&  1 R0C4 h :X\\1 R0C2 d L1XU1S00 R0C4 h :CX0 R0C4 h 0Xn R4 h 0X R4 h 0X|S L$p -p8phLP$M}/ @1P8 #K3K 8KpP ((K躟 4K]  h R 70P9$ # ! 01( ! #  >  7'p0C x'00p7 h' <0`7 pp0d H'00@7 8'87pp ?"K2K.K0P77"[   6Q Q2 Q +>2K t6"K P2[S&000 , , T l6F@K4K 04K6 P@6  [^(6ࠃp6  P şn@ 5ĥ 0@0A @ 0 x0sU0@   ) ( % 000$0f104 4@ Q P4$H4}.  Ǭ42Q$0004Ql$0;0Lj4  ]T4^ʔ80\4\`0@  0D4\000(4F@  0܃@0 @0 0 @@ 0l@w0 @q0 430s@d 0 @_0H @Y0lb Y20Y 0@I0 @C 0?5 +0B 0@470 @- 0-0 @% 0#,2 Ÿh2 P0À 0P2 P 00 01 0( @ 00  @ 00 @ 00 @0 @00 @00 @o0l @0e0P @0[8 0@<0 @020 @0((T'999:09+ 40682:FDJ#<D$ H0 ; 2:89H$'j),'_eNa///////6` -LMP`p 0P@   "0T 0P  @0T 0P 0  T)40 T0DD @T0 T 0P  0T 0P 0P   0S 0  A0 0 0 d@갠 $@@T 0 d -L M@, 0 Pp 0 `  "0T 0 `0 T&40 T0  TJ40 T 0  0T0  00S ,0 `(Koa@`0 ,04(K 0-LMCÐS3   PK0 -LMp#8#h\30 @#TăP, @aH,$H00  p@ e0d8dÕ#hp @,0  0p` U(K -LM8 c@ P80 PÜ 4 0   "0T  0P  @0T  0P 0 0  T0L40  T0DD  @T0  T  0P  0T 0P  8 3Sy 0X)0K*0K4 p 0S+  0PB@W0   0 p*0KRPE@R  4*0K)K?p Pp 04P?W0*0KXW60 0 0 840dP 0(KPU  $  $0 0  0 *  $@@ U80| 8a 4 *0K)K_?XX R 04 d9$9 -L4M3sēPL0 S  c$  0@ p0  T0  0 0 4О !0T 0  $'!P @L03(K $  "0T00 0 @ꚞdT  $@d  0T00 0  0T00 0  H0T 0T @0TtJP 0  P/HK 0  @ PHK %P@/  I0T @0T 0TIP 0  PHK 0  @ P|XHK P[@00 0  0TL' ; -L(M#3s@ #S`< X SS *B(KS 0@S4000T# 40U3ƅU#ƕYH0I0("V3$2#3"2̓3#@0PSPU0X`X+  @  0@  0T  0@ 3Sp13]P `00@S8K@ <0 P Y00( K#"0RP2@@  0@  "0T  0@  0T 0 @ ˠ@ <0  P9 К "l9 -3L $ 0-3PL@ $@0Õ00 T0 p-3LSp,_`Ð0@00 Tp -LMÐ@ \00 ]8]8-Ð0 \  ]8]8≷ -L> p-PL`b? 0$@(, p ᗷ 0-3LS@0PÔ 0TœÔ 0TP㸜UÔ 0T0 -L@h p- ML802"0 o@2" 0P 0 脷”\  Kph 04 $ Kphl $ Ц "" -3L $ -LÐ0 T/ -LM 0 08^80 `^8޶▶ -L⑶ p-PL`ᵶ? 0$@(, p  p- ML802"0 o2"@P 01 0 ”\  Kphb 04 ?$ KphV8   "" -pQLPU@baX?0OOP$` 2>AB?bPP``0O?0@@ cAQaQ p- @L`0T 0TP$ U  $8P pp -0L040 T -,0L8l02 0;+c -,0L8l02 0 ;+c0 8/;0/ -1LMpQKP 0K 00`P 0@  T 0@`\ ڔ 0S 00 S R0Ġ T 0$ 04 000Ġ4;tgncxgZc `g/$0 R/0 R/tg4; -0L`4P0S@00 T 0T 0T 0T 0T 0T0S0'0 Tp0 T}N@T  $  T 0pWd㜚}~@ $ pW 0@W}~ $0P0P@0T𩝨 @9 0-@L K04 00P T0h} -0删S/0 4p 0  0LT&40S5  $  0PT  0T  0T  0Td(@T  $ P P P000S7 0  T0S  $0`  T  $Z0P  T  $0@  TZTU00# 4 0 0 S0 00  0T  $0@  T@0  T0@ T4P H$Hğ0 S00 S Q T <  Pl 3 R0  0m0  T0SN\ ܳ ĵ T h 00R@P0Q 000} zQ  000p 0@000iRf ^ 0 002 R  OxI t Jl} G  $XH2 rt0$ 0440k"0S2 0 @0 0  < < 0 T  $@P40  T  $P000  T<< 0 T !0 T  $P  0T090  T  $P00 0 00 rl tg9ncZc 9 , < 949P99l999hg2:9Ȕ9ܔ9d?j4;lg',9Е9 -PL `p@\ 0T@DD0 @T0 T 0T 0T @0T0 T $ib -LMP@pP 0`P  0<<0< 80@` ,0 $ $0pdg<;d?jtg4;8;pg0; 0-LMdP`0`@ @0P <0S,00(0 00hq tg4;dgpg 0;9 -LM@`pő}^PU  $  P50 T00 0 }^PU  $  PtP m̒PU  $@  0T 0Thg N0 tgdg -LP `c0pP $  $@ $ᇒ 0Thg 0 tgdg -@L1t0  0t0i -PPL 0R8p@堀`T Q):W0  t0 oE0#@T(娠 ` x p0 0Rp0x  l0  2@ 0X<T0040 T+c$^8 -L M80`S4P删  $8 , ;  $@P 0  0, Y"@0  , 0  , t0 0t0| R,0Hr, ,l0p"200SM  $Y  $p l@ 000 啒0Si 0}x t0 0Rt0x ?  $p  $0T *p@0T@, 0 0 00 T@|0  `0`S  J0CT  $ (KT<0t, l0 20,Pi 0 00  T^000 00l0 20,P+c -L M@0pPtpx0p0t0"<<0W ``U 0p` Kܛ9:9 -LM"p00AP4`pt0  0*$K|0Sʤ0 0 D$H0S t00t0 RR 0G 0-H0S H@TP10 5/00 T0S0 @ @T  $@  0T 夠KR #H 1PP @ 0@ TT d00 T0   B0T; N -LM#p0`0Q(@d0P4,0 $0S T @(K0, R@pp  Rp  R*    p0p pYp# 0S $0R 0Y0! t@H"2d |@|@h!|0@P0C|0 WApp0,00 T, 0T0 0Si $0KS00, T0000N 0N 00$0(  0 9S0&6R l0d!20P  0 00, T@n,0 T0  ,TI4,0 T,0 T0,00 T 00, T,0 T$0KS0!0, T0, T;<9+c -LMŸa48@, l ሠpPP(K0 ,P`2Wh T2W4 @0CW6 42W I1CWd ;1CW7P 00#3000000000 , , T0 00 0 0 0H1WG 0W0 @00, , T1W 0W000 000 000000|0  @@0@@@,  @ LD ,0@$P@@a0 0;+c]t@yt ktzt lt -8pLW`4@P t0  0@"00C S( ( p p p p p p p p p X 0@2Ÿ 0i @0TP 00 T0 TH40 T0 T0) 0KSpږ SpGpӌ0Sg p0 TdG $ 0Td: $0S@  0T0 T0S0  0Ti 0T 0T 0T 0T 0T 0Tr0 T $<<0 pT0;pg -04Pp008@L `T0 T0  00^  0Td㳒 $d㪒0 T0@00C S p p $ $ $ $ $ $ $ $ $ @  $0 T0 hC 0T 0T 0T 0T 0T0 T - LA8P4pt0`  0  l0 20 t0  [t0 0t0 IE%000 T<;+c - (LM$(" P4 80 W0qWS 8P@U5 t5% 0 pE   8Pˋ뀀 0 X t0  0@(K4  0S 0@\$%$5 ťt@P t  t0S ) 0Ҍt@́t#4 0 0@>KP0T0082/`가 p-0 00 LR`$ژ0SP00S PU@ 0@r 0r8P #<Tl]pPncZc 0-LMQP 4lB@04 pt2  B l•p @0\04lB@04 pt2  l•p @0\0////0 0 /0-#204S0$0 0A>0 0!2010P/0S/0S/P/(0-#206S,0&,000a>000, R000000 /!2010P/(0S/(0S/,P///800="R$ //0 000// - 0p`L80@S@ l~X00090Y ,ou4p@l6P8}K og=j9Ж9 0-L@P0hQ p-LM H`T  X@ 0 8g040 0b7Kp 0K0%PPP@   ,0 0 ( (@ ^ 8 -LM800<0 08 =P}80s<0"0080<04 @0 ,04@\^j4 PL@&j, ;, p0 0, 4R0><ʅ0 S00,0 ,4 0PLCJ 3( 25 < ( 480, ^0, P80@ B00p*0 W!`<apP- ,#(0L",A P p4,80< 00 80< `V(08 04p090(Ko苇(K<0$(Ko<  (Ko9 p-LMP6H`T 08 0$00kcKp 0K[$P   ,0 0  (0 ^ @8 -`80$ @RL0p4PP00x00$1`00< @0, 00 00C 00$@202LP00404 -LMD < @ b 0%  0 <0,  @,00 `,0R ' @"0F08 @ 80R64 80 p2 @@<`:#:zc>0PP4*3 S R Q`` `0F 08 XP"$> @ 00C 0 市8 0pDP2$00S (K0 0000 ,@ 10R0S 4P@P<P 80 00 0B$@Bp -L M80+p` ,P4@0Ppt ,0 Pp $ 0000 ,P  0,K D,0pP , j044080< % 108< 0, 0 00 P22$`D0L@0%0 P0,!,Q 100,0P,0, ,0 P, 02,0R, $`ք00 p04lB pt2   lš0p \0S <2S p(Kl@< 2  o ,l(0 p-LMP㘄H`T 08 00ɅKp 0K"P   ,0 0  (  ^ @8 -LM P=b@Vp  0S P1,0 P1,0P Y0F  P, < 4,0p 0P  4# 800 0pS0000Y $ P 1,0 @ XX 80,  O"PP$ ,0S  P 4(p,` "k j( d0r,0 oH0,0o@  ;;;;; ; 0- 0LS@P ^P 0$P0 POP0-80=\  0 `\0d hP` -LM=BT (KX20X2嗃(8,X,H40 (HЄU'Y P$ $`V 0SS lP80S 0C0b20000#s21Y P40S`  4P$0U00 W 0SSQ 3N 4 <00b<0 L, 0 倐3. 0 p#> 00Y R00`V,0@ 1@*C6"*0S8# 00V,00,0 3 YE 0L0 @'D0 R8SCX20CX2\$p0W80 @$0S 800 00lB pt2  B l˜0p \Z00 Z0 000΂@90S@N080b|g0 j|g 0-L@jPPK2#0 -L0M80p="R =,+ )0*T d<0@ %0& $('$Ru *:R eR R R 0lB pt2  B l—p <\00[@xᕃ$K Rk  R zD9R 0RU80 R S 9R RV8VUlB t2p  B l—!pP ,0 L#Ġ# (K 'K&K%@K(0K+R 2\8R 0R 0V8V!0NPPS񟗊x              D 7R RqU000~|7Ry 0Rv 0wRr 0sl7R[VY8VV!0NP`SP P     \                      X ^ǕA 0AlB pt2  B l—p <\-lB pt2  B l—p 0\Pd "=2P SlBpt2 l2p , UlB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 6\l— pt2  B l2 p, H%lB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 7\lB pt2  B l—p 7\lB pt2  B l—p 8\lB pt2  B l—p 8\U=  JN4S Sr S0.Ÿ@(U@1@# @8 C4  02^/ 00l— pt2   l2pH ,O`K@' 8 M0K$40#  $<@L KJ0KK@Kl— pt2   l2L p,P 0  @P !0 0R@1@!  O0KXU00U0 0 U 0R0* R# R   U`1 `#@f TP1 P#p@e (T@# x"l P P x .s# #8;c;9J;S;\; 9 -L@P0hC -LMplBP t2  B l2pP ,Z <0 @1pCWp!$W"@T`l• pt2  B l2 p,/.00 b` T!0,!@W 0 0 m 0-=2LSP0$@0h轀 -LMPP "R pWR 0``b00v0=2 VlB pt2  B l•A0p \4` X2\"0 X2\"wnhR@EX2V0CX2 lB pt2  B l•p 0\4 04 l• pt2   l2p ,` "pl• pt2  B l2 p,"`$@``lB pt2  B l•p 0\lL `P80P8P`~ $P(7`0P8vꌗ9`9L909 0-LMlBP pt2  B l•p ,40 0h -LM`0Vp0P`VJ =2 SlBt2p l•p ,4 0S`VZ00h -80L="R <2S 0-LP.P@0xT0 -LM80P=b0V   , 4@pP $`D00%0  00Q  170<0@ ,, 00C 00 2p$PL@~004p090G<2S a0( -L@P0h -LM8 P`p=2S  $K0 0 0 4@ 0(K(P060( 060(202( 0(0 $L@}(0T   $P(0 S00( 4090lBpt2 l–0p \0S <2S ~<2S l@  -L@SP0h 0-80P@L="R 0.P0<2S00 -L@2P0h P =2S<2S / -LMp0  R0 0Q6  090dP4 1 0@9P02>U 0 <P@O0E?01P E 0R904 0 @RJ1?P5@TZ 4  8i~A PP/ 4 @3 2 \!l—Ppt2 P l2p ,l—@pt2 P l2p4 ,l—pt2 `P l2pH ,, l—pt2 P l2pL , L0@ HdlBpt2 P l— 00p\dlBpt2 P l—p 0\@ cl—pt2  l2p ,@ T$@P@T 4 OlBpt2 P l—p 00\l—pt2  x2l— |,00 p\lBpt2  l—$0p \lBpt2  l— $0p( \lBpt2  l—p 3\lBpt2  l2p ,lRp t2O  0l—@00p \lBpt2  l2p8 ,l—Y %Ypt2@a  FN.B B c0l—#1A80p4 \lBpt2  X"`l—1p@ \lBpt2  ,l—:pH \lBpt2  l—P 8p\lBpt2  l—pH ,0\lBpt2  l— 0pL \,@ Pl—`pt2 ` l2pH ,@ T0@@ 004  HHDH/lRpt2 ` l—4p1 \H 0@\N|g9p;ܗ9@%I$̐;!З9 -LMl`ppt2 p l2p , H H81S[ l–pt2 p l2p ,lBpt2P p l–0p \@2l–ppt2 p l2p ,@dTP ,lBpt2p l–p 1\lBpt2 p l–p 1\  DlBpt2 p l–p 1\9 p-LMPl• pt2  B l2p ,d B`0 @`0P T <0`2pV0`2p$::9,9@9 -QLMp`G Q1 Q i65<2l–0<2pt2 p l2p ,DHPT8 lBpt2 p l–0p \2{<20C<2lB pt2  B l–p 0\<2l0<2pt2  x2l– |,00 p\lBpt2  l–$0p \lBpt2  $l–0p( \H8SDHT lRpt2  l–@@ 0p\lRpt2  l–@0p \lBpt2  l2p8 ,l–LH pt2P  10CN>C 0C0b l–"!HQ0p4 \lBpt2  L8l! l–p1@ \lBpt2  l2pH ,lBPpt2  l–p:H \lBpt2  l–P 8p\lBpt2  l–0pH \2<2 0CD(<2L(H(il–pt2  l2p ,@@lBpt2  H(l–00p \+l–DXpt2 p l2p ,l–Hpt2 p l2p4 , L%I$ p-T0L@`TPp@T 9S  @Tp贪g/ -04 10@LP  >00t*R90 2/ q0@-P( HT L) 0!"4# 8̓ t\0S \0S  RJTPP \0SX00 -LML9 @壀妠᧐Č Ȍ89p:`< =P 8 ;>@4 ?$(Y0 , 8K00K0S@d !0 K Dc`(KX P P/p0: p0C*:/p0: _0C*:/0p3/0 P / 0 0/ 0-LP@@7T03: F 0-@LPw 0 0 9@)0hx -@4LP R00080 0 4P0,0 0$0(0 0-PLwIT R0009 0  x0 -LtɐP@`pP/ 0 0@0=00000090000L)04 8<@0@t0x@<08H04@:< |0l10,0\  D ` \ H00H0=j~ 0-9L@| . -0.@L 09P h&!h9 -L M0 4 L, 04 8 P , 0S ,0 S Sm SP p0lb(Kp0PZ 08< 04P`40`L),0-./4 8<4@&"40@00 ,40 `0`p`0p`pL998< =>@ $?:P(; W , 0480P`40`V0 :0*:1 0C*:, 0@ p,H`P0@pDP0` p0@ L#D <P`0@(!(D#Lp4P40``}̘999 0-L ML@! 0Y"4#8 0 K00SPtɔ0X R1X R0K! 00P000SU\p 0(SɄK0p 0J 99 0-PL@_00P0@T04@9 p-@LP`uP0S @ 0 0 0 8 80P8 phwX9 0-PL@uP0S w@ 00@0@0  0|9 0-LMP~@# 00  0   l (00(0 ,00,0$00$0K0@t  뼙99 0 -L4 8<S9 0-0LHPT JT LL  fP00 -*LR@ TQX0X0X0:TX0*R*R TQX0X0X0 :TX0*R*R TQX0X0X0:TX0*R P\ R`0`0`09\ `0 , PP /Q00090)R   -L@h| R/0S0S P/P 0S00 00괪g p-`PL `R@ 0Sp0Sp R  P00p贪g -LXM@ %,  0D P`p0 %4 8 < @ @0 4P `p$8, (<4@,@0D8,(K9 0-LP,0U@  % 0h耇:2:X9 -L@E0 ?0 <@ <0  -LXMt@KpP`} ;wK -LM@p`Ett91XPU UV yut)1L)p 08`mX`p 0di+E Kibu`9m8$ 0R/1H <6 p-L@Pt`QphHu 0-0PSL S 0T0 *TX :P P0S 4@0TP0 u@T0P00T RX0X0X0:T X0   딚9 -`Lps Q9 Q7 Q3 Q@ : Q, @00S"  0R& 0000S 00S0`T0:X0*T`L:PJ 0@L:PJ 0SX0 Qit 0RX0 Q묚9 p- 0"# "L@Pvs0``9H:UH D0 20l&#PP0`9t>pP9; -*ML 0e[ 0S/R !Y -0LMPU. $@KF 4P$ xW! \iV`V P0 48<S@T (< P@  "KzWꀪg g -LMp)(0!@ *P 4"`+#8 < m 21C0a1 @8K +< `0004 8\ > o  P0 48Q Q| Q>  0 $ (,   048 < 8  P[0 48<@(0) *4+8<S(KO0 0 PP0   㷅0 $ (, Bx 048<#,##Ƞ 00 $(,0"̠""N 800PPPW00PPPq99 -LM Ly@W ßX9 "10 0 0 cP $̠$$$H  @ 0 P$ (< L  "\!4!!̠""HP 0@0 0 !" 4#`8`P oVX ",0( 4;2( +>$0"` Y405 6478`:p ?;P L<$+4"2L)540674 8<2L)! 0"#4 8L)405647 8p.p T!.!̘!d>!p!"!x5!\#!4!|2!1!)! >!m! -`PL`:pS 3/t  㕁L  㑁P  ㍁\YU  ㆁ めTP1S10 $8S :S V*R:::8*:  h_ -pQL@T `0X`STP l!pl1` m`W DU@00=j p-@PLPp9`S'U1"n0P9`9S d9S 0 3 1Cͯ#PQH P iph=o090 @ 嵯9SU  0RQ9;9 -D0L@@8 P8 P耪g -pILTp@T `hP P  08, |@pTWmu9 -0LgMl`pPm/K0\@mP K @]KB K0 SRK0P `@0 @Qd&V <0@0@T0@!U=jedA(0 S-$0@LA`9SH:Sh3 p- L0410T`Ut@n h9S L)p :S0(0phX00`00%SE 5S< '(S *SPp*M0(00 * S S SP PS S SS S SPPPP<99 -@L_E`9SH:Sh袭 -@`LPlVp (0S0(0(0:S 3/P# :S"T0S TT RX0X0X0 :T X0 0P (0S 00 0:S 3/hm Ls0 0 Qh9E p-@PLn`~n0T0*TX PH:ʄ0CH:ph]n p-n`PLhnJT TQX0X0X0:TX H:0H:Dnp -yPLHz3n> ,0 W9 * Ʌʅʅʅ ` Y@\9\`0)40@ 480<$P嶺`WO! 0-@PL YU 09 Ac 0 )> 0 9Y @9l@) S P080S880ł --LM K00,8 01- K -dL@{P , P  舜99 -@QLp` d:S3/HT +^L p pP JT +^9 p-PQL` L)@0h 0@ @@4pXU OL p FP ZU pO9 -@L`p  P~PL \ X)RxG  0p)t R t9 RX9"100PVp #Ppt9^ 0 S0 S RQ  PUp)R t9 Rp 2L!   1~PP  ;9Ԝ9 --LM K00,8 0F, K --LM K00,8 06, K<0 0-PL @P0վP0g -LMS8# 0 $,K VPaXI 0ĐK:0 . 0l0 0, 0l!0 P` Lp 0|0 H D P P P H0 0H00 k 50 , 0 S ?04X@ `p XP1X#\ g  b?04X@@,P S(K 00P@K00@@=jT9,9 -L(M`Q* 0K )$5@T +^@T  pPP (0( >@ D @D }@ }(KhV +^L p P jV  P0@0 D0 @@  P  @ Lɖ0 48 S l(KL)! 0"4# 8  t@X RpX0S pW`  p`X R AX0S  R m h0   L K 0 ,KTSP 8,ğ@, l1fPl.K,0fP  l1,f,O0 (0K 1RS L K'SK 0 P @1   K0@  " "  !Lɚ 0  Q~?K0S@T1 A AT !Qwr ,0- .4/8<S * L K|y L0Kh 1PP 0P0Q0S?L)000000000K "LK\ ,0 `0L 1002@3 48 0123456!"#![8 1[ <01[,0[-[@.1[/0!1H[0p!XV cwLyB`XII8  \ITwt @pɆP  9PE l1,c,Lp`Q P!U0p`Pq Oyx"R 0S0202x@P ܠ9ԡ99=jedA9Л9؛9999 0-@1L PR "RE HT P0S J0T0R R R 0 0hp)R \0S \0S R`0 lGP0L)p 00h*@9`9 9 -L4MpPK@`P 0Xɔ\048 L1 $(T\  K"1   P toh1U0@K `0` %P 0 4 8,R1 R R R 0ID0 480 0 0-0/,.@00 @ @ @X\ !0 48P00marc9;x9CRAM̢999 -LvM`! &((0"4#2r 40  $,KN@P P    .u)u(K P, l1bP ,rKA A A l,.K0 b@P] ,l1bPP,\K  uP z  uP Q AKXYQ K<Xp 0S&40$ $,K! NP^, l1aPI0!P DA0 48Lx1 $(T\ X,l1 a,K l1,a,K s \11 m1U L K 0z!1P @,l1 a,J > :!! ! J |3F (;u@ 6u  0! $0@9=jedAmarcD9CRAM9h9l9 -LM0  80 upX "10!PP4 piV0` * 0㨀00 ,0 40 \ P0\X0048 L1 $(T\ `V X0S\`V)t4 t0(K0U \ 40P,0S \ 00\000  t. 8cL  z0,0 000 ;marcCRAM -RL,MT `M Lp0@P0  tT0p900p APt0\@X0+ LK 0,KiMP. ,l1 `P, h,0 `0 0S @00$@S 3/p P0sP T0pW@P(KP0P 0P0 (90P0 ,I0P0 =j;ܣ9 -L0MOp QT0 P `= (tYP A  t0p\9 }PH r ? Pg/0p #18#hV*PP@VP$ KP@ H@K 0 `?P s m(K P P` P 1pX 9 "  9PP02 P P P p@ P! L)540647/8 <S `````?  I2Tʚ0\T9 x9|I @ *0 8\`P@( L 0 4 80P 0#,##8  0L" 048 <  " "4"Ƞ 0 @ p9S 3 #;@0Lp @ T T0U T * 1A C`P `TQ CPhYT9aV L)p 8L)0f\IT x: S 3/P  @TXʚ\n  T0 Ȍ?; ,H  P $#LK09=8< >:; $? (H3 L \(@,P$ 09=@8<>Č?:;P|H Ȍl0`4p$H3 8HLH H0sLHO0X0bqL"RD 0SH0L202gq(XP( s48 2K0s0S   P 00h0  CR <#00@3  @0 QPZ.S8A8L 0L@0<X 1 @ 0rD3 ! 0` @ $P(V|: $Z% <L@K|L 0D D30@PpČ@嚀Ȍ`,@ $Z 80R L <K0p 16K   ` 0CSr PL#0@pL382K0 L p88 XYV4cPPXpU $@ o oTP o`W0#R P$@ n nTP,PU $@ n nTP,3S ,@ ,C nT<*n@*n8(K0Q @  P0h0 $@T  PP X@0S?*ML#@s :p.$?P;Č (/@ȌL  0T@ '`P0\@K0@P\@ XP 0%SB S (KP@K X,̠h X@\ XPd l $Dt ,|T x@ X0 @t%,XT", ,,$#8h[p0 PKp[$4OKx[| X 0 @ ȌA 9@8們 墠崑弡 DxA :x儡 壐 1đ 倡帑 ἡ̌ ɯᘑ 唡 唑0OxO;Oᄑ刡 đ ᰡ 刡\ t >Kp ` O]K< Ps `|ƒ@]K t p! 奣S ̊Q `P]Kpq 夁 Kh d jKY਑ 夡 |d Vpl l!tp P, ( {눣̊`q \ sP $q T `hPK @Xp4A K0@`1 \A dA$ V9|L9L) 0!"4# 8̓ t 0X Rc 1X R]  Q|~P5P(K\dP|1lQL)p DhqU`hP\!d1R夑 !""4 ",<1 4 0 8! l  08P|lL)p lA|1xAlQ0p dil!XhU_V| l|P 9|999<99\9@-L)@ 0!"#48 <29 -LHM` 00K\0 @l#X@ P\ L)! 0"#4 8<4  L H  ?< 80 ,00 H@4;T$P0 T U\0P@t 0 dkVTb 0D @0 TpKP0 SOK \D0t !XQG`,PU  lh hhTP)ah0@V@P00S X"l1 T0> (Kl0,y/K00U@P `02( K01SS^  th  0`P \`P KU`P KM0  @P`405 6478<s; Ah\p0 0@0@` \ , K,@T+S @T 0 48<S P Kt`a  `YP K8`R)gn=jedA9ܠ9,99D9 0-L \P@  S  L) 0!"#4 8<90q P02 Q " RP0#2  P  00-P0 L,0 0) 0@ QH8LH@0@ \:*808 X:T*000 `:d*(0( x:*0\9ȹ!!$!h!!!D!! -LMpL K 0@PPP,K^@Pğ, l1SP ,< #g.g g(KL K|Bl$,lh.K0SP 02( K01SS L K$* f.f fC,l1 jS,<L K g\@,0`0LK h@00@L)LK5406748 < 000 40( ,0 zL 8H0 D Xfm0a 0 0 0 /0C B0 @0C B0 @ 嘐噐嚐囐圐坐垐埐 L= B`0 71235640 00  !"#89:;<=>?@)!1H0!X f(8P0LiXԙ  \f t ᜐp$ f @ 8yf0008   B5\90L)\)(0*+48 <0# #Ġ#+)*(0P  fU t P  f.f fL K<* e =j,9edA9ܠ9Л9؛9d999 -LM<`KN_Kp@K\"g ll Ǐ  ᗏGD\A(K -LzM@`TpP@K z/ K肏K,EZPU @ @RZU@ -LMPh9i)j 4k8|WN@ P4K  K!0 " #ČNȌ@(`̌h ;p 4K  ;r ?PP ڿP -LTM0 00 $ (<S S Dj$K<$0 0@ QH8LHhAP T <$0P H PYU800\PU 0d0P L)xKT N $L)x t 98:p<= ;P>`?< L#?1SDOpPU! 3! (00  l0 `PP0 HLp !]P0@pPqx(sqol9999|! -LzM@`TpP@K z K肏K,%YPU @ @ZU@ -LM@Ph9ij`4k 8Xp @P<K  (K  dP 0! "#ČȌ̌h  ;p7 @8p80<@(Ko9 0- @0L,`(0 :0 9 0X*T:9T!d!h!@-L)@ 0!"#48 <9 -,0`S0P@L(00  L pP0S ppP 0 (0L p, 0 (0 ~9@9(9 -L M0K!`!P. .  8   0LIPty40 !0 "# 00P1X R#T ty 1X R02I )(KLI 0! "#48Q8 02A  000 K  jP  80Y! 0"4#4 8<S 4 L)p 6p9|9Ԩ9 0-L MLI! 0Y"4#8 0 K00SPtɞ0X RO1X RK0K! 00P000S/ S 0S$0S,0S= U!H!0!!l!!\0<' \Ɏ$ K0\0<&p 0\0<\0< p 0($0K0h_ |봪99m89 -LMP@`2Mt)q0X@T& T X!!h!!!h!!V V ZNt)0L)p 0PNV0X`p` 0d9+" Ki?N0FSV ViV V9m8 M-L0R TKL9',&&Ƞ&'D'X? 9:;=@>P8`]@?P (4\N8Č0@;p^`d0 `@ _@Ȍ d K  `t@0@P$`(4 L8d l:N pLW<GdkᣤT+45L VV\T P0 T K \ XP Xl h Q=tP l h XPh U\l Z `0dP ច@ 0 D @0l0 ,  h@0 Ph<,, 唕.h8 4 lK | x < 4 pL tPt<t8 K <@H@PYʠH8 K @ Pp J 00 0 0  00Pd K |KTKPT  2.  @   0@ 0@ JpTTt*X :P@K( 00"嵋 0 ttt&L)&&̠''<'H0@`ptPLP 0\K@0@| S[ tPNLP t9SX0|K@DK| x 8K\0K 0K ` pP8 4 SxZPtL9L) 0!"4# 8<P`Uttɐ0X RI  0X RA 0@P1QtL)p xTt9S t6P} tL)p (Kot 0 x b l h0 tt@0L)p <\Pt lS9|9999 -LM00K0 @%@ P0P`L9P]!\ "@ $#`(^ _` L ZP 0`KP PP0@U0@ 0Hh d 嘀dP0H 0c0C  x t h R 0 8@Qᄛ4X T0 x0K0 @ H0 D@ X0K0S@80 4@ h@K0@P@@ Gt9q0X@T% T (!!8!h!8!8!h!V V fHt)0L)p 0PPZVX`p0 0d9+/ KiLHV`9m8 -L9@] \L^_  p/9 M-L0Rp`  KL)0_^0\]LɐpG] \0^_48<4@s ǏP`7"@$#$##\$d$x?9 :;P=`>p80<@ Ki꠫9 0- @0Ldr`0 p: 0 B9)D0D X:T*<0< t:|*404 :*,0, :l*ī9!!!0!!!!@!! /@-BA0 0#^0E-Bl pA`P (  0 8 , 40<`. VP踱g-\0\   0"  P1 0<0丮gg 1 0c/Ḫgg-1 0 个gg -l`@QLU   ]YP@0p0 10!  \긱ggg -LM`, V@Pp)   0` t@P# 0 0 Y  %YP 0,(K P `P    - 0@ P`L,0S(0  L pp 0 (0L pDppP 0 (0(99 -`@LPwEp0S  U R P H8 P H8 0 gX000 H8 0H0,iF - 0L00T0 *TX : 4@T @T -LM 00K0 @L-@ P0PL9娐]!\ "@ $#( ^_尐 T ZX 0`KP X 崐0@R0@ 0Hp l l0L 0c0C   p R 开0 HQ<㣔4ˉ|0 0K0 @P0 L@ p0K0 @ pKH0 D@ 0K0S@8 4 @0 <@ 凔ˉd ` 开>@ XBP K QHQPK  p K `KK`VpX ?Wgd p K H K h d  8`K`Vp `80K`0 \@ \d Qʏ 0hK@h d dW 0hK@h d A \1K8BL0 @4+ 0 " | 0##@ K D0@S(ڨ 0tx t0 @ 1X R02 V `0S hY x t @D0 SG  J  .)90hK肽T  oDP @PhY K  V T@ˠD @PD@_Y X@ @TX@  0OᘀK 唐 T T HX  v  PPq  Pl 7h@Pe T 50T > K Kh @PPL` K  @P> K @ PP1Th K  wP  `@ K  @fP0P @ K VPo 0S` |(KW@$ `0S\X@ hYd R@d\K V>W<FV`| @0##ഀ` \ H\2 @x t hT K  HX@x t P   0 0 0h V{`0h@SsjhKTYhD@0 T? K @@ @T@ˠ@PqDX0@V & `^( h\+ T;  #0} K PND0O\ʷH^V W `^\P h\d^t@hKx0@Ÿhx 0@$? D PTֱ K  TK@_P` K @ PRPD\I0@V* `P, h R/ x^2 T+0 !00 0  K  +PD0O\=H^:VW `P\Q h Rd\ x^tP"HQH^H\5A\ 0 0@ 00T 0*TX : C(K̫9H9D9P9g99ث9 -L MLɐP! 0i"4#8L8 K00STt 0X RM1X RI0K! 00T08 R- 0DR࠳ 0S,pWT4V !!!$!@!!^0>& p 0嶻^0>' K^0> ^0>p 0H嗻@ͺT `t9`X úT冻 99x999 -LMP@`;At9q0X@T% T 4!!D!t!D!D!t!V V cBt)0L)p 0PPWVX`p0 0d9+, KiIBV`9m8 -L9@] \L^_  pH-L) 0!"#4 8<0S0399 M-L0Rp`  KL)0_^0\]LɐpG] \0^_48<4@s ǏP`7"@$#$##\$d$x?9 :;P=`>p80<@ Kiꬬ9 -L@F00 T_P0  H p:09X*808 T:t*000 :*(0( :l*̬9!`!d!!!!!!/// -LM  0)UU#" -LM) 0UU#" -eL`PpZ< (00p04S80,0d0804p 900 3, 0@07< wa&((0"4#220&$ 04 @ 0i};Ԭ99WEV" -P L d&@ ᵘpP` 1TJ x1T) *`X1T* P1Te/`010S ` 0 z`P 喞`P0T% i0 00" 0`0 eS@ 0be/ʭe/R 0T %40$ ( 岑`(crdAhdsd edAk~gd" -DL!88#!<P1 Ip" D0020p(P00`t004Q!80@aT@!0   Hv800d<0\?@ k @ oE0 8+0@00 <K?@ Z o@H W(c;; 8 8-#TLH%p`P0@ʛ {›(c 8 8-#L@(ʗPPp 0`ᯛpP 0S  0,p᚛0 pP(c -L@0LT"0L00⡜ - ؀L`p0pRP$  R@P P00 `(pPp 0P,p0X@P00 @們 i(ccc9g9 9///800S SP 0S//<c -0L -L@\p`\h# 10 0 P 0ぷW hַ,9P9 0-PL@e0 00h -- LM K00, 0 K -- LM K00, 0 K -- LM K00, 0 K 0-@0L@PT@T ⧭P0<c 0-d0LP\0T 0@ST0 00 @QT0<c 0-PL@ 2QP 0( @ P00S0 0<c p-1LMQ@P 0Q 20Q 0Q @ 0Q 0Q 0QP@Kp0CQ*0Q(`K 0@P|P  @40Q ,0Q @ B&B"B!B$$B%BB*B(B -L0LP800S$ 40àL@cd?jZc -T0LPp<0P 40à L  @cd?jZc/ -d0LPp 40#@"B ,0S 3/0P @cZcd?j - 0L0Sd?j 0-HPL0@S0P0 T00  0d?j 0-p0L @R0PXT0LP0C00S T0000T0000d?jHc/ 0-<0L0PS@0\0 0008#8S0C0S00`7>p 0` T30#T 0` 60C00 #T0$#T'4(#T 0` T30#T0 08#8R000 0)/0Qq0 01(K 3 p,0 P @0T @,t`pPUu囲jn9 -3 ML /003c )@  0@ T30 #T0@   V3 H#T 8#0T <#0TU3 0 @#T0 D#TP3SB0 #T0 #T #3T L#0T@ ,#0T @ 0 T3A0 #T @ 0 p P @#2 TXP@80PK@0#0@ TTpt! 0 08#800,#@DT  0@ T30 #T  0@ 9U#  00 @#T0 D#T3S 3/ @ 0 T3# 0T9 @0!9T(K H#H0T9 4#0TNjn -PL@p`S7T1T% 0CT/  08-@4T 81T 1T0/@4T6@ @j86 @" \]8@`@P608#8@6@@ B6@06'@F@Pi 7i 8i8 0-L@6P*0h*8 -L38 KM@ p@0@  0@ T3B0 #T0  @ ,#$R< 0S  0@ T30 #T @ 0 D , K0`,0 0` T30#T 0` <1 60C00 #T, 0$#T, "4(#T 0` T30#T 0 B08#8 Q000 )  #$ UP` P`0 0@0@ jn -@L 0  0 0h꬏9 -9p@T  L×0#T3#$ A?@(0,@×# 0TL0@(0,@×(#$@ ,(0P`(P,` -9T@  LÐp#0TC0#T×$#$2?0@S, ×0$#T3(#$2,P`0@0×@000(#TC#0T×#0TT -LMÐP0 T3 $3@ @$@T* "T|Õ 0T_ 0Hx`@0@ 0b T ixT TA@pp""P^8 -LG-@0 084 0<0   0 0 84 0M<0   R0 P ` p@  l0 P ` p08 40< 00 (0$ ,$  084 0<(00 ( 0$0 ,, 08 40<0 (0$ , 0 8 40<0  (0$ , Ѝ^8p^8R@- @0 08 40<00 ($0 ,4 08 40<80 (0$ ,< G-SkM0@   0 0@0@P@P`P`p`p堀p 堠Ԁ$ؠ(,@0 408 <0@0P?UU[ [`00p R0@10XHA0崀0㸠P @h1X100 (H1@,00 0#00 c80`1*dH`n`1lȠppp0P,& #'a0 ` P0eZ@1P1 (@#@0b*,0c̠0 c<00*0$10n010dLp$1'P#1  #P1\0T1@1,0D100(0T1`#D1&@#0nc80`$1dH0(1101(1 &#1` P#T1eZ0X1D1 0H1b*0 *lȠ0(0pX1'a#H1 @# *0l̠c<p`q0(q1andL`p1& #1P'#h1,0Sh1 \U0000 d`X张0 HȠ 0\LĀ8! P `p蠝0@?@ Q$Pa(` q,p048<p@@pGp?PP@4P`0`kߍP h 000QhP@4P`0`G-Q0`Pp 0e01 Fjjf>0:-: 3*f?*0A :  :**   P0!V!" Z!P 0 `Pеglgȫc^8//1s s0@0/ 0@0/Xchc/@-;@ 0$@/@-:@ 0$@/P/კ$0 -LQh}m8cg 0-LMI20!@0SP  0  (2KgT62T00S USU00 , B21C 2K0}LcԵghgg -!LM0p8 e 04 ,0*CU(0 0c b"HS0c aR bX00S0!((R08  C4 C2  C1 0  R1`1 0ࠟP``0̀"#100 00c4 J, L:P "80p`pV!F`p800S ,1(K4Kv|ԵggLchgg -`LMKOKp*tᇝ!P\PK*MO( y(f2@Kcȫc p-@PL` ;@U (V1(#Q 0 0#0PXP,XHH ( ,喞00+ 叞 0 pȧccc,cj0c p-L4ML@K`$PKu 00#0 QV 8*1($1(㒜Kp(xc -LP`p  0BPP  P@1J# fpP  @00$!PPpX V*Ag -L 00 0  剞 x0t0 R h0 iP LzS@@ hz !g@[8;ga0cA"gԵg,B" -TqLPL`0@T? 8!0V0f0056*V .; U,| !( 㺝?V0 0pS PV@1@!c X` ᥝ0`d0dS0 VLmB0D<,L 4, 10cxc0c,cȧcccȫc p-LM@` Q@KpF_K @P㔛@ -LhM@pTK  8A T`P10KS "  S@1J#U0  e@P Ug*@Q e@P0SU@ K@PfD@KPK(:,$K w(=P -L MKpm0   K0cȫc -PQL M 2KpQ 0 K0c 0-LMQ/@T1 !0S0C0(P0S; U,| !( 㺜?0@ aK` `ଡ଼0X0C0Q/0D<,Y 4, 10cxc0c,cȧcccȫc P0-PL0e@T0C-0 dpR 00P`U%  \00 N @ l3)^Q<0PU TX 0> n1 ^2X X R h@X0O|0 x@ 4`S< ph P26B 0bC  R7AQT7Ry 0P 00K |K0Ph `@800 j H0l0 |K48d R 0@@PSPT00S40,00@8V` w0<S t0X@l(4 K0T0@0TV ^<t\,D06040H0D 0  H0tz0P D@0 :@^^ `P`p4P8`2@8P 8< d UL 0.S!#@DP@ L T pX 8L PF>8jHt 1TM8jt0<t+D060<t X@(0T04 K,@P>V UF40H0`1@0P 04 P0ftbt H y\@ ;pl0PL! Pl0*0 t04PXP 4h 0K 0Px T0Sm*7t< V,PD0\@ 60 < tJ,@PD060pXX 4U\@ pP<pg  R/0S  0/G-0 Mv~h1 pW000@  Ѝ1 P1@ENa$!0.@OBdg@ eg  0\n0R LABA21C 0#!B0 031C dQ *V2S/00@0 S\l"l"l"l"l"l"l"l"\m"l"l"l"l"l"l"l"0m"l"l"l"l"l"l"l"l"l"l"l"l"l"l"l"m"h@`T  ἓ 0P,0pS(0$p@0`0 0S000 (K`@T (000 $00a$0 `ᐐ@`p@`d0\@`0pd `㬐 F@` pd@d%:9gg0@- 0P840 00@0 S9!000Q0CV@ @ 0)0[ P 00CV@ dU )@K0 0)[.P ;P`a0@0S 0@a𯝙aP0 g)0[;S -LM00 \=0P` p0pP@ )K 0 K0@S)0[)0[;S V0Pp00p(K.XpG/-//d 00  \00/ 0-L\P  @L P004  0 0 0-LM0KP/@P00d0(R @F@0 -LM`< @0 \@><PU00K h$PP :6@p@700dp0 @ `P 0 Y (K<P R,   @Q 063@\0`@,P ,K 0z@P,0H00 0P X0TP\oLPP` 0  8 40<@T0X@/ \` 00 Ra 0D040 4 ]4  4P ,P 8p"#600APxw" w"v"v" w" w"hw"400 0 @P 00d d 00"d00 0^ 0 0@ @0L @_R. 00<0j R 0a4K/0 -Y0T.0 P -06AT 0 7F?P0S0 0000P!0 S80 0 8"F* A 0/,K@P, H@00S#0m ,P 2 0LF 0_ ,&,c9.cc0c99 99 0-RLM@P媜 00\9 p-L\P `  04P8`O 0@P`P `$P(`,P0` p -LM\BP`p0S00 ` -Lp  `1PP\BX  T0P #0 ! 9 !5$0\R:$0 -L8MT`$, PD p(K+pP Pڸ5 Up #(!0p"W@ 0S!pPh0 l0S00 H < L @ 8 0,K/;pP,0H@ ⵏP#0SL S S@ ,P I0,0 dY,P @0,0 < R 0 DD Q0DT0 X d pT R00,P &HQR ! <# 0!"Yt 9 z40\2mLQ, <@ L ,p H0Sh0,8@ H ,p X@X T@ P @ < L@0P0$ @0 D8@0P@ 0 K0@0p '!Pc 0p a " 9n41@<P 0P84<  0< 4 P 0P" 444 08 40<040  ( 0$ , X00 T00&@L\D  0 $ *00$ D0`0 Ph 3 0000# Q00000@SQ 8 P@" Ԏ08 40<0  ( 0$ ,@0 0H\ KT0`4 0 0C,K0/Pp,0 HPh0h0  ãh h ,(h 0,0 g |9999c -LM`$@p(KK p pP$0 \RP K Z 0pPc@ 0pP@0S  pP  KhpT d 0 #40S pQ8P $0; 0SP  p !0(!P / ps @ZA_PZ ͏ZN Z ŏZ Z 㾏 op  (z 0PP nc p- 1LtM1la PP0@ PP >Kp Kn PP 0K$P PP 0   B   20h@P0 00( 5 nc=jLgcg999h -LM@ pPD@`00@<000   ;tx 800 7/ P H@fP 0S S 0P@`UVP00 ;000 $B Q0BP( ?8 ; 0^07<@`0@p P:0p0`007\0 (Piᾋp 0 @, Dv, P|9WEV T0s 0s0s40s@0s 0s l0 0s P//0/"/$0s P///E///00CS("P"P"X"P"P"("("P"P"P"P"P"P"P"P"P"P"P"P"<" 00/ H00//0d 0S  0%000/ʚ; 1s s s /40@0Dl00l /0@0 0@0Tc4cDcDl R0l0/ 0S00/@-D0@Qd0 < T0P0 $ /00 000! 001@Q@- 0@ 0$@/!00100000@Q 0 S /1 91/0d@2 - L⌗̯9 -LMPp0d0CS<l0tS q T ` 0D0 | Kp0S@t0@ `Pt0s8Ht<`@`00@`;00@ 9 -0Ld@10 d@42 -L@ -L@wz -L MHd@P0S p K0 C1 0(K pP ($( H 00S@ 0S0 S%*&0" KP 0S0  R*(p(0S0 S*[ eUp<"[00b0"[000"[00b0h -L@ h! `p0PS`3l58` p`#4UPdchs -L 00 ,0 ^nP`U TR*A1 @f0P  0004  (K 0,n`0lV40 8 T2*. A.0P@ @0 0Y  8 00< 0S0c>0 a00 , 9@@u@>00l0, 00 $@H""p" -L M(p`@P K00` pP 0SK -MLM@,4  0+2` 僒 0PP?22 VL* 1RI 1RE \@ @ T;*0S P 0P: +p 0PP  0R0 S, ⚅P P * *(K$0  (1 0(1"" V:@p1(0SBNK@D+0㶷P@  ,00卑P ,0兑Pۣe:9 -L0>0 1! `c49chۣe" -L}McPKp 2 0pD @h00 @ `P P@T `@ (,00w(K(!0G`P@D(0$ (!0*`P @0(!hPK 40b`P5P5[S `0  [5)3[@RL 0PI`P[P a %a  ^ 0S!!(0K"  1R01  0>. 00b>01 !  x *1n0A0 a01 1S" H S(K10!   " 0 !.  . a0 S2Q>222>30300 5X*  ! 1 0K~P PH  ! 00\ . 0C0b"001 0H1 0! 1 1Sʼ#[Rp  1Q8   R `0 4 Q!RQ  0 c, 0K4K ,0KP\:00\,%* , b 00b$1 #[0,0 0,! R:0Q*"!B00  0 001#[c `0 1 , ۣe" -LHM8QH1U@$0 p DaV $K 0rP3P 0 0` Ȍ. qΌ@P 00 `7Kp -LM pR`$K0.>0 0`. 0 @P`0 `P@(  0P``0 `P  . . 0`` -LM @R`@" 0:#:S%0:#:S z'zW P @  @ Ȍ PqΌ00p @P K0@ 0-LQ@ P21C 0 P  QP P0\0 0 "!B?$00P0 -0LS`@ p2PC@0 0 000 p@P00R00S p-@PL? 0-%2AC `q 0P  ?a$`p p-T1!!1@@Q0!L00>0>0 1 R70P/*"`!B ` 10a 0`0PP PPP0P:"!B00` 1 0 10a0P PPp00C>!00 cc!X$cp"@0l_=j0l=j 0-LpMx@KdPc@ 0P6P P $LK0H\5L99\9 -L8MB 0R<0 0 !yR0S 0`0  a 0, (K01 :0 0*@P0 `PUh1PU,Kw0@c 00 啯0`Cp0K 8@ 0p 匯X/@F 8KⅯ80 PKD KP0 L@ Hp P& P PU 0- ,04 Kj 4K1@K@``ds0 30K2K0@ ]<` `F<K U(K,忉(儊$傊g9 4cذ9g999 -6堖LMl|0R\b6壉IhС6q`g'1 ܜ3)HP( Q 06 R0 06 00  !!D 0(D  !!` R0Pa 0 40E00S 00400 4 0S00t0 0 `0  0  !!$ 0,$  !!0)0C 5 T81 L[&E4 00<Ԅ80 0A R4@4@@ P  kp@P0@0`d @0FP`pP`pX@\Ph@lPp`tpqT@`d*1@@@3 @!

!1 P5 tt1 P, ``1 P# LL1 P 881 @Pa(!00O !0H^Pڈ؈ֈԈ҈ЈΈ̈=jg_8H :gg gggggc9$$g(g$;ЕiPgAj`?j ;"g$gg9L%c9ħc$9hhg.P9g"l9"9"9.98/ȱ9g9899Ա9999t9\90X00X  / P/X0S0 /0SX0X00/P/0@-@PT! x0tS X R x0S\ RX0X 0X0t0St0SX@0X0X@0 0-L@PX0PS00 0U 0S0e00 -0LS@ ^ x x0Rڭ00C0 0X0 X0 0t t0S - LR@ X0S0@ R0SX0X0 0/0S/0S/  -L P 0 0  -L  P00 0-dL\0PU @0$0$dNPU 00ZN0h#c#cg p-P@L`0$ 0CR0 S 0S  0R:l0\0p 6Ne0\0p/N 0-PL@k,0@Q0 p-`@LPZ,0ph? 0-PL@K,0 @10 - L M, 8(@," T3 Qb0epP + ,((0 S@0P 4`  "100 0c4 0 @8/X 0eP00e0,0p(,40 0b0(K_8 p-LM 00tt0@Tp P0 S$ `D0 iO0S@Tp#cg#c9 -LM`@p$0S $PP0 HO$0S\@000,0h 9 p-LM0@Sp P 0R: `  40O 0 BQ *phs(9 p-L` 00 ;@ 00W @f  PPp 0-LM@,0P00x`0S h0XX N0SD R00 0S000h0g#c09#c -QLME hp0OO$ Bb!R^V )ڀP@p 21C Pp, (P! P0S 0xx N0Sd X00  RPpPpU  h_8g#cd9#cT989 -LMZ, $ , 00R00SZ0PRZ 0O Y `, P@1PY `0Xs 嚃(,0P`0BOP`?jP0Y;;@Bc p-L Mt0Ϡ`Bl31C0Q$P `  D0 R 0P@`$ $P `   $KKpMb?B p-\0LM`PP0PHH0@^ ,0K(P $@ ,` DKp;g; ;g -HbHP0 LS@lQ RP L M 2 00S- U 0D  DL00CSL0Ȕ1SGUx00x040 0@408@0UL0D0!0D00S000i[pD0 7L0,0CSL0p00p0T!R/$0 0@$0(@0@!0HKL00CSL0ȴU T0S t00t0,00 @L,00@H.0 0@0 @<0 0@<0@@=j4cggg 0-D0L 00  !D D !T00CS00@P0S0 q ,0, @o0h gg4c8c 0-L 0P! P@#!B20bcp0p l0@@`0`0QS@@0 R@0h\M(p3$g;g8c4cgg ;gl9 -qLlQU $0"  0`0SR G?0$1S1 R2 H00CSH04N!000{VPh1@P ` 0S& i <1~QP0  !$ $ !00 RH00CSH0ʨ \000 0@@0 A?0 1S d0HQP0  !$ $ !0=jggg;0g -D0L 0  !D D !\00S0H0 R 404 @,0( }h gggg4c8c-A" J1S 1 0<S RZ020CQ^1S100S^0Q:/0P/$0/ -L@P00 p-0 !L$ Q$b1@sP 0<!0 ! 0U 00C0p0 #  1 0 10 0C0p8 2028/ (("8/00/ 0-0LS@P P R000 ! 00C0z0|gg p-LM0`P~@P P \-P Kp 00 0 0 ( $ 1K0 , $01KP K$00$00 00K P 00CS 0 00K P01K$00 $0 -LM`Pp Q B  Q D00BS 0 K0S@ @P K40K,@ (P 4@ 0P K  ` -pL2`0C8#8S2 P@U R 00 0 PU@Z@@0S'020"R !',  "  !'#P y P u4 8!@ <hy! ' 0020"Rg - Ldw`@,H00000C400 20  2$g9 -LM8,0,0 ^@w`H uP ^ P Z,0 2 0SKH0 PPp@0 0 0  Pu u u u,> % 0@SPPS@ R 0s 0S  0I 0PS@40s 040< 8 @ PcUڃ ?PcUU0' !02@r 0W ' 0@' 0 q A0 qAg9 -LM` 1R/2P 0 p!, 0' @A /u d}v@ %u dsv0SY02, 0R0(K000 02Q0p, ' 0,P0' @p@B@BA  t,0! d ,0 $ 0,000C0YJPG   00Qp0 ZP圐 R00 000 +Y40j@0 P,00,0  B 00 0 @,00,0  B @0 g p0Z2 4  @"!B$ⷜ0 j[00SDx1x! @KB4pK@0K,8 pD!Q4p 0 , 0p=)A@ -B4p 0 , 0@40 0@ , S X8 ,0R  L 0R 0@=9 =L H D0 4 `0R 00 k_s e 0#SP a@ ^MbIJ9;Q?B -LM0`A8@sZsqJ D3Zl 0S QqpPm 00 040PP#P*80QUKPUH 0S!0S 0,0 T Ub 000 48 0(0 @0@ P56  ,0 ,00,0*  ,0 ,0@ R0,0/ W 00CS 0 p0    ,00,02  @0  S, clP  0p `DaD2 <D0 Q@P 0`EP3 D圪 (K #D>00,KD0 @P0` (PX |`@,t 9h0@X 4,1h80, 8!D4<0 0a0H1HcOc9 -LMp4 8 @P 8K` P*840 @10@0!0P,0 P@8 ,K ,-P8 0,0 B0R,0 P8  טP'00K@ (K4K  ɘP`@Z`J,K ,P0 ,0@T0P,0 ` J ᱘P'00K  㧘P -L$M"0D0H 0 p`P Xp X `dT2k X(K00 (!(`P(0$0! 0@;00@(!0`P1 I (!00`P0 gP(@ 00P,K  `P\`P:, 0d0b 0 R`/LA03/P41@  X X (1#208`0 @S00S 0S X ` P  0S* `K00 (!bTdj`X$1 !S`#`3R0 0!0 $0S Vl`jDh|cdc -LM" (12 0 x2 'pP (K0  !x DD !`K0 c]Po7? @0 @ p 0%.Kh2 T" 0T-l \2 I?K'KHq dr ,q 8q Xr `b l1 0>00a#6x0`! . `1\!0>0>00a#6 |0 P1'K>0#60X10T! Px"0@xd A (,Q $i8P 4!z l\i" 0p|<(<8h"l?i  0  !x DD !r?P[ p  @\t@ H 00 L@Kb'K |2<$P x"< 0`Px  ,$ax0@x1|AaxC_SP wfT0XS0# 00 ex2Z/6x004@pp1xT40 ]@0!!x0D  D !!xD @ 0!!x0D @ D  !x" 0 !D 0 D  !x2 7 R 0  !x D D !@0!!x0D &D !!x7 1 0  !x DD ! 0R 0R  (0 0 x"2P 000zx"D0 s0@ 0@|`$0@0@0@D4@\h"p 0x@ <,0S 'K3/P< 2'K (x<Px"D0  )h"l?B x28!R PQ <1R 1/H!0+0 @1S+0  D06D0<1H R 'K 2/<1x810  !x DD ! #p( x2@eCx21C0 \  &q 0R 0R0R0!!x0D D !! P' 0!!x0D 0 D !! 1  (1`0 1 1"0,@ 040 `P4  `V,I < K4K V@@PX/78KP%" 0!8P'X8 00040@4 00408 40 4$00$04  00CS 04 |<74 , <-4 8gc8`88hX$c/c 0S/$ R(0(0(0 , R$0(0,0$ (0,/ -L@(5f 00C0Dgp$c 0-L@P $ R(0(0(0  M 40P40 wdP * h8f0) f 00C00hggl$c -P@\LP` pP 0  !D D !@\@ &h5@ @00$S$0#@0.00h R 0 0 0 ,h -`Qp04!L`a ,@T ,0S 41 r $@T{ DP v|< S# )0SD  $0 0  !$ $ !Y1, 00Sn P cH R )0S$0*#0  !D D !, Y% H.0400 $0  0  !D D ! ,Y.04000S" P c\ 0| 5Pj ,0 Y0>  0S hP b   @9 p-L\M0@ S`  K\0lK`,PP0SQ K P 0S Q lKP ؒPKpP 0-@L84P,0S00 0040@4P0h4\$ch$c 0-LMP@T  0T6@T 0 R404040 $0  @D0 `M0  !D D !  % Q4h$c\$cl9 -0Lp@P , !$ $, !`0S T  T   R0000 0 $ s hX $0 s!} 008!P0S 3/0 0R)0404040  R 0 0 0 $ : R 0 0 0 D  P0S0 0 0` ,@T% $3W@ $pD0? S=C  !D D !H R   %W@B$0 3h = 10CS1N P#000<m1S@02#41SD0 | 0yqe?4 @0S  00 p 0  !D D !b lGDD0 ^'$0 10CS1i30S.,0Su 0!!D 0 D !!("(> D@ 0!!D 0@ D  ! 0 !D 0 D  ! 23 y$@,r6 l!3! ah0Sh ch0 @3 R 0Tp 004h|0S  % Pp ;pP s'$ Dl$ggЕi99g9 -L  -LM@Q K00  P u % l 00/!S  = S (!8hP @U@0AS00S 8P# j#(KQ0Y08 0AS00S hT7P0#0C0@P1Y 0 0C0j'00C0Q0'0T  01p0QPǟ 0 B0C#0 p`D D0 )0$ 8_D0B8 Bg^D,(!L000D v<Ys 0  !D $$ !10 010D 800D0< D0 0  !D $$ !8  0  !0 D@D !.!D  D  !@0DY@0#0 81L0S D3/D0\5PD< @A0 04 < \ P` 0| 0O0@0@0 D0  40SP"Dş, R0 0 D D0,@  01DS00!00400 D0,0 010Y40000S 00, 00R0$0(0$ 0, D0(  , 0  , Q\  0/4P 0dPd0 Pd 0 d ,0000d ,00@P D(K,0 =9 =0 @bPY  D0|U * XY@ D,#80P00000000QD  80S  D0 n \ q D",0Y  0 e l"00D0D000  0H R L0L  !$ $ !  P`  0| 0O0@0@ * 'P  \!000KD  {D0  (P` 0| 0O0@(0,@x" t"Z D 0)0@00D|0Q0 b100Z/0  !0 DD !6 ;p$cPct$c(9;l$cDc09Dg$Ԏ1(g gggЕi@B89 -LM  0  K -LM@`0,(  0@ @zK\=# p-LMP0L S`@Kp0 $K0 $0 0 Ɍ@P($  0 @P`T@D=# p-X`X0@ TL p04PSP0 '@Tp$cXg p-`0L@`TP 6/p  MP $ `P@0p6hXg$c@9 @P-0 Ã-L0 -QL@M'0S S -$K0`@KA< [ \<  0&@T   0&P P pp0 0\`P@05f@ xf!]PU`V0 0 Cg$c\g9 -LM`y@08 K !6P$ K @鐮 0$@|0 @夭```0pCAD㊾0@P@$U<`KHc$c\cg$cggg -PPL0 aAᰀ0(B(2 Sp`< b|0  %0#.i @F T`ڲ $0&ͪiggg$c -1L$MP`(!31Cp Y>00, Ã0ʃQ #0@S00'0,0T0a(K [ f!>0 C6 00 6P@40  04 0P @@@PPP" ,  Z0 0cC61᱀00@4 0jj00S00#00!P0yfg9Hc$cgg̳9 QP3-L@P`p:P ἷU hf  Sf900/0 0 l10S /0S/=j 0- PL@][0h0 Q0B0R/,00 l R 00CS0 /=j -0L,!,M10 `l  P@p0 T  0S (K,@ D 0@0 8pK 0+ < 0T@ D00+<0S  ,#,P =j `8 -H0L l  R@0 00P00=j0 Sl1 000/=j  0R00/  ]0R/  T0R0B0/80S880/ -LMbp<0 P @2Pp8 lp (K)0 " @Z2`00Dp00@P,PR0Sppp4P 4 10S 00<000 00*  4, 0 tx00S88080<1/0 8PR00,K  尧pP@,0SH0O 803/00@ 0L!,00  00000,P1 0  Q00; @pWpW<8  `0b 0R0@ b0 @ 0@S TA\fZ,0H0x40S4 q=j4h!Ce9P Q 0, R//H0 @0 P/,0 S/,0 S/0P/ggT0 L0 P 0P ,0 S$0//ggH0 @0 P/0 S/0 S/P/gg@0P/0, R/0, R/P/$g -@LT)0S0) R Q % !@T - 0L41@SPp ` 0S ,@T$@T 4P 0SD0W00000CS0$@TR00000CS0 - 0L @R |0S0|0 R000 00CS0 N[ hJ[pg(g - @R0L00 40S 041041 -LPp`=@P' 41T\ V  [[ u 4q R000 40SL 4A0S0 00P@VA 00 @P@41  XW0  !D D ! `00!@ R00!p  q0 0100V 8Z0ZS41 000pg(ggg p-0L 0 !@PT`@T 0Sp) .@T P0@0S0`p@T 0S) p@gg -L@ 0@T @b9 p-1L M`P ```) 1@a AQ0S 0C) 1U 0AS 0 C)h1J 0`!SI 0SF PD @@ 04Y`[[ 0k`[[ 0P`[[ 0``[[ 0`[[0 0`[lKph[\|b ;g$g gg;ggg@ggD9DgL9gX9gd9gl9(gt9pg090,/,0=9 =0/ 0,/04/(00/(00/D0 0000/(00/(00/0S 1 1 0\ 0S0S  \//(1 P//Z/0 00/P/0D  /0"R/0$1/$10/ -L M0P4! `@P KW@T@ 0-LP\( A\308! 'P@01 00 -0LS00  0 001 !U\ U00CS0/Xg (R/(!000 - L V00g 0-L@` PT000 0-0LSP ` @T00P0 0-@QLP 41 P ,00000, Q PP 04!4 0P0 0-@QLP 0, Q 6P0044!  0Q00004000 -PVLP@+*VTp41@ 0S V0,` 0h0, R @P P 414 P @\W0, R P 41  Q@D0 @(g -@L0|,PUphU41` R P 8W,W 0Ppg(g -LDM@pP`Vp(KhPK tpP0@\ l0 S S8#81@0 , !D D, !l -` p0(SL0S 0S PP@\ S`@0 , !D D, ! -P L0pS(2 0S 0S 0S P`@\ S0S PPPP@0 , !D D, !]0U0U -` p0(SL0S 0S bPNP@\ IS`@0 , !D D, !$ -P L0pS(> 0S 0S 0S .P`@\ S0S PP PP@0 , !D D, !Z P 0U 0U -@tL`(Q N 0SK 0S 0S 0S Pv 0S 0S 0S PpP\ Rt@v`t 0S2 @P0 , !D D, !t P xv 0S tt 0Sv 00Qv 0`S -PuL`(A D 0SA 0S 0S 0S dPv 0S 0S 0S TP@p@\ ;RuPv`u 0S( P@0 , !D D, ! v 0S uu 0Sv00Qv0`S -PuLp(A` P 0SM 0S 0S 0S Pv 0S 0S 0S Pw 0S 0S 0S P@\ QuPv`wp@0 , !D D, ! v 0S uw 0S -PuLp(A` Z 0SW 0S 0S 0S Pv 0S 0S 0S |Pw 0S 0S 0S lPX@\ SQuPv`w p@0 , !D D, !u P VSv 0S uw 0S@- 0p 0^0@p   p0 @  P`t0@P`P`x0@  ɚ;6e -l@L 0 0xpt -LM` @08@ 4P @P@ P@0 , < @0  S0 @ @@ @(K 1 R1! ` 0 0@P  084 8H$ 0 0@P<0  0@@0G$S:Ȓ#В###В#В##В#t#В#В#t#t#В#В#В#В#В##В#В#В#В#В#В#В#В#В#В#В#В###В#В#В##82W, (2W 0W ![_`0@0Y @ 0G)^$W *W W^ )^WW @ 0GvW 'X10S 0@0 0  G_0G=Sꄒ#В#В#В#В#t#В#В#t#t##В#В#В#В#В#В#В#В#В#В#В#В#В#В#В#В#В#В#В#В#В###В#В#В#В#В#В#В#В#В#В#В#В#В#В#В#В#В#В#В#В#В#В#В##В#В###!E-D0u 4Qtڀ4Qo 0xW 0S  [_`0@0 44\ L(4\ 4\O 4\W00CSK 0@0 3\ 3\` 3\  0@0 3\g0C\=3\: ʈ3\0 3\  0@0 `3\: /T3\6 0C\2 +0E$3\ 3\ 3\W603 0CQ2Q 0@0 W0 2\ ^ʜ2\ 2\WW0ST h 0#40#"B L2P82\#2\ 2\ 1\2\ E1\zWx0SR SsT  0#40"!B 0Sh0C\k0C\ T0\t@ 0@0F WDWA0T!Q<D1\ 0\m,1\ 0\f1\ 1\81\ 0\10\ 0\@s 0@09 XT | 0#40#"B $0SQf f@oB@i$wt@m"Bwd gdt,`trtti$i m @t,@ht@~fli@Ni48i8Zc"{t sd !B$LPcl '"i !i B)BedAvtgtp- D0 [_`!0@0\ @ 0pp/ -LMDPj S  0(Ko [o0@0] 0@0 ^ ^  0@0 ^? ^ ^p ^s  0@0 ^ ^r $ 0@0 ^  0@0 ^ ^X ^ ^> ^ p `@C, 0p `@-S  0(KoCX7Z 0SS(K0NS^9 ^XZ0S 0SS S0S0 SXZpWE `VC@TXNZX X X Z XZ0SX`Z^0S[ 0SS SU0SRXY.Z Z KZ (ZQX4 X X X XxZ p `@uZ ZZkZXKZIXNZL0SI 0SS SC0S@oXZk Zi Zg Ze Zc Za Z_ Z] Z[ ZY ZW $ZU ZS XXGZKXBZF Z CXFZC0S@0S=5-Z2Z/X `9p@- D0 X`[0@0 0S S (0p@K 0 R p 0p@@p@- D0 W`[0@0 0S S '0p@% 0 R p 0p@ -MLM6D0S ,$ ,(KQ  RW`p00@ [0@0BKA+P, p[0@0 PW PP` BK@, .HP P`!P &Pk :P Up 0[_`PC 0p[_`@00 , UpVBK@dGP pWXBK@8GPJ[`[0@  0, { P`0@0s!Pʹ0@00  [0@0  0@0k U1 p[_`UpV0  [_`0@0 BK@JGP? 0p[_`BK@>GP3 P`VsBK@3GP'V 0@0K  0@0h 0@0/BK@T rGP pWMXKBK@  GP BK@^GP [0@0( BK@FP P`[BK@FPE0A[_` lp!BK@\FP,T  BK@DFP BK@0FP BK@FP 0Sw0St0[BK@FP BK@FP BK@FP 0S P`=BK@ FP 0SM0SJu0S0[hش9999`9999 9,9<9H9T9t999 -LM0`SpP@ Q@ 0@lp D06D0  +,0Kv@P0Z7 0S P1  cD@P 0 S00 R 0# T 0PS+  D0 [?S  @ +T @ +@//=j/=j///0 , !  !/ -@L 0@clg0 , !  !/-| !X0"0CX0 R 0 00d  0  ` R0>X!00X1X!R|tg/ -|LX0 0,X0!00 @dd0$@d@X1 T`@00 V𨝈06p0 0 -L M@1P @8p^@ K?(KP 0 0 0 gnPT (`K mPW  0 41$0 SK?"(( 3 K -L MP0 ER@0`@V U U; T* !1, 0 $ ( 1$  1$00$0 1$00$0 1$0@0$0 U $0,K0$0 0 0 (0 n@PV@ ,pK m@P @ K 1$00$0  1$0 0$0  -0L)0p0 .!D D@.!PP%!D )D @.! , !$ $ !0 Wh`0@P `0S W000 0@@0gg -$0`3P0#DLp!0@3PN = @@0  "! !  "!0 1D D + = SN !(2R.,0S>? D 41 R8#8.W0m I@`D  D  !0@3P@R 0  !  !GD D8#8.0.B1W) @ BD  >P  @0@h0  "! !  "!0 |DM$c9 -LMpPD`R0 An Z @ ND5 Az 0  !  !,  0  ! 3 !0  0  !  !.!$ %$  !$00Z00S @T T @T,0Ss g)0@S Sd S`n V (Ko5 Q005; H0QP  !  !(K0 110,0 1,   T1S0T1Dž 41 R 0,0 0  !  !i$3l!R 0S  RFP RB $ 1 P82 (Ko4Y )0S$0 D  `h,p3Y00Sk0P00S`U @0  "! ! !("(0 D0 V* YT 0!!$ 0%$ !! , !$0 3$0!!,0SD ,P` H0S` 0)060  !$ $ !` 12S20 1Ņ$0 j1gP0  "! !  "!k00SH0Se $0b  _ 00#!001 00#!$c=j0g - L lN h Pp-L`Pp@TpU  D0 U@Tp P-L@P h S-pL $1@T P,0SD0 h 0S  P X*@TZR% P@T @T P,0SD0h P X   04g -LPp`PfPU 0 R Q 0S U U U hldP@T0P \ 0S U U U @TU @T p-P` UL@0P PQ $1S p= @ @P  0S ppUp ~p@B -(a@LTPp? U𨝈T$T = D @@P  0S  @P $0c P UJt T 0h d0h 0hP @B -0L`P U`TpP@pP` @ P` 0U0T0S t T 0i  0i d0i0$10CS$1/000d<g 0-LP i:0J/@80$10g 0-00L$!PR0@0@0 0-L MHPHH @<J 0P@=K0h=ggH#9 -`L00@P" p9 0@#P1 ^1010  !!!0 ! !!0P1Kx 1P 0R 10P0$c -$0L@S ?0D  10 P Q$0 0  !$ $ !L1Q1$0  1| 1 !D Q 0D  10 dP0  !$ $ !0 , !$ $, !$0 -LM 00 0K 0 ,9PPp 4K Eh`PF, 42 RpPX 1HL &`Q5 0D  10. P +  @0 & e01 A0 !   ! 0 Q` K {h`(K00 U`0Q0  #`V+J 0 ` 0A004P/1,pǏp@Xw0SPpPvQ`PqyAɚ;c9;; -0L@TD0  0!!D 0)D !! 0 1  @T+ g -LM@PDA ~`01X\TPaD0  1! 11  (Ko!0 008 @ 04/! 0 , !  ! !00V1 0!10101(K$c p-L`P0Sp@ T0p @T R0000 0 @Tp R0000 0  s -pL@` PPW` P 00  00S00@ P0-LPP@@@T: 0P0T 01 R0D00`B9 0-LM0PS Q@ R  R 0A@S0@ 00SK` gP  0 B0 00 0@@ 0 @0S0  -0LQp1p!WP4 0 0CW , @ R W`1`!P$0 70S( f\ 0 f0 0 0pf0@ fW0 @  P0S  g f g=j -L M@P0 x#0S l3@T ,  0P0S J7P@PTP,P  3Pc c  b#pP 좟  XBP` 0PP 32C0  2PpWR 0S@ P D"0L"S0\,  h,"Q@`62P P6/, X 000@8 @0$0(@H,0 P0408@<d0Hp0TPp`WX00pC!000(KT 0pW 00 P`P6, X 000@8 @0$0(@H,0 P0408@<d0Hp0TPp`W@o\%cg(gd%cgh%cg8g:9-P  0S 34\^ eQ/0S /0 (=j -@LPp`C6T  0R 𨝈UT hVe M-PL0 0S R K P ?e -PLM0  0S R P K)e -PL`p @ 0S 38PVPR00SP0 @  eP00 hd -LMP p, 5U`$,0 SR00 SU0 0S @V  dP00` ,  Sd000V R S  DdP` @A dP00: -L MP K -L MP K p-PLP`  0S p@U@R00SpP 0 }dP00p phc p-PLP`  0S p@U@R00SpP 0 WdP00p phc@-R @Q\ 0@- 0-LMPR@@ KP0T30%K00 p-LMP PQ`&0@S(\####l#@#(####T##T#t#\#D#D# ####t#20S K3/P 0Kp20S6- 2p2 RxŸ 0`Ÿ 0H2H"@ 0@cFP0 Pk2@FP0 P`10S  <10S-10S-10S- 0V P`1`!à0L  P$10S 1 :0~ 0 0b 6%s 0 6k 0e 0^ h0X$ QggOcgl%cc$ocЕigggg8gh%cd%c:ch?j -LMQP@` E 0B@S񟗗#################################################################0BRS########l#$########$####h#$#L#`#@#$##D###,#######8###p####8##X##t####P##0#############X###d##8#8#$#x######@#p K 0?p 08p 01p pP 0R0909^ 9R4 p 9pA 0}2pȟ 0p&R88\ 8R 0ptȟ p 0p<ȟ L@j pP00R00S870Bn  #>K0B ,R ( hpvǟ pn 7~pg|ǟ 0p_`ǟ lpWA 0RpLǟ YpDϠ 6-p;Ɵ 0}p3Ɵ 0up+Ɵ 0mp#Ɵ 0p0 \6p` <6p #~K 1 000Q@@T0 @pA  0pE K, pP R 0S$2S 0 ,Qp 7pğ p 4p40S0000 00  00KpD@ PpP0S 5-p <4p 屶p|D0(K ( (0p0nß L@; pP00R00S3ZC,K , dpPO,0 CRS0FpDHß 0p<A 0Sp1ß 0sp)Ÿ 0kp!A 0pŸ #pPgl xŸ p\Ÿ p 42 p 28pŸ 00p pA@ pP00CUSp0S OP`d 0!୐#l1l! QrUp #NKḒ 6`pP. p  0p$~gga0Z8$ hH%cgggMb-cZ8p$c ;.c, hLh h|g)c(gxh=jcg$;Z8d?jL)cigggX$c(cl$c<;(;;Ph@[8h-c4;Oc8;hhDj -L@M0PS( p$ 0B S@$KX`K!R_@P 0@PX00C S 0$$$$($$$($($$@P -@Ha P (K -_@PP$ @P1( H  a R*; @`````` 0?}@P (0 (K0 A pTK06/@Q  |8T Q  c_@@#T%cЕin.0&%t#1& 00  R/gH0S/ RC40, 0100 0 H /g00/0 , !  !/-0  ! @, !p3 0-LM@P0 Q PK ^P000 0 ^0 ^0p%c -Pl`LlA @ pH4< 010dp `Hl`  @@=jg 0-@L ǿ 1 1PQ ! 1R 1Q !0)00000 0-Q0  S  0RLPlAQ 1| D00  !$ $ !0A0 0) 0l=j -LMPp0  ! A !Q ,`K 0r@TK -`L PSF4 01pPU H0@S  PUi|T0H00000 0PE ) Rg -L@Ph -U0L0 u 0@T `@T <0S`<0V<0V0 00c 0-@L H0PS )0S 0  !$ $ !0h? p-@0PLlQ`p`P PQ 0D  10 P  @00  ``p `p=j 0-0QlALP00  !$ $ ! H0S H0S :0 )0 0Q D0 10 P HP0=j -\ Ll$0K 0  !$ $ !#LQ =jQ/0lLa =j p-LM`\P0 R /0@jhKp(@K0 0zjPAP00U00SOch,oc -LMD `X@ p@ V0<0 E 8 Kq@P08KTg Q OPL R @<@P#@(K00@TP c ZSp!0h!OS"AJ`]ZyD <@<@PP ,K (\P,0S@ D 0<0 D <0S xD0|<x 0t E@tD 0@<0U 00R  0@k ;;c249 -L M0@SpP (`K [P K`I -LMP\pP 0`  JL u@ KS`0@K: !.n`E @ P0t03V0S@+Och,oc 0/c0@-,P@@40T @0S0%c0@-,P@@(0T @0S0%c0 /%c -X0X@0LSL }?’D0?< A3c 0 0 ;t%cMbcp@-RRP` ڔP`0Q @0p$0@p rP`<0Q*0P`Q 0Qgt%cx@-P,0$\ $0(@t%c -L(M@Pp Pp 00@PT x0H`K  d 5 + @D0T  0  @I(K%c:@94: -L(MĐHKP@`p +  0PP (K+P X0@T @T +P@Pt%c%c-Q00CS0$H$d$x$- L0 80q0 0 ^cc -"LMp`D@ @0<0 @`)@匒P0l^@`  @   1 P` A$ 0@ V 0$@ 8K0K00@R00 ,@  8PK`U0 0@0@Q08PK`@P`8P 4` P`8P 4` (0@cT@PTP@DT8PK`(P,`,P50@8PK`4P8`,P`5<@0Ā^@  0OO$[P`% H FX%`q(`< @P0L 0 @P@08 0 0(K%ct%cc@Bʚ;x%c%c$$ 00S0/008cc 0-0@SL  0h21C 0`0Q U! 0 0@ R0P0R0 @0 0R0 0R0000 $A4>4;%ct%c0L9p9@-HpDP@0$ 5^0`@0 @0S%cʚ;@-HpDP@0$ 5^0`@0 @0S%c@B -LM @0,0 @ P`p0 c5F$0@X0 @  , R @0SW0@ %c -LT0; DKPPpK8 PP4V4eO8KjD @0 <0S F'D0K8PK`< 0P `QDP @` < 0P@`=9ADP @` =C<0 0$K0<N @ 0?B(c -LM 8 P&Y  4K&& 00ᣃ `p04` 0p  P, #4K  UPZ 8P (K 4K UPXP400,0%"O04@`00@=)@ -40 0@ , g@B -LM@pTP $`K0P K mU0PU0 0P$@K T0P0 p-L M`U $@K % EUPV   =UKp; -L\ 0C  !L !!(0)0|Gl0S|0 S|(l D0 !R 550305059=j0g T*p 0!R30,00Q0S Q0!R 0S S0 R 0Sʵ! 㾽8$4$0$($$0T  $\99d9$99999 -PQL 0 Qp0S`0S 0C8S 08J@08 J 5RZ 8/08Z `0SE; -0LS@`p80S)0S  3/0PS-0U 0S P  JPp0S i?00S0hh$0\#0S D#p0  ##)c999$99 -QLM0P0 4 ,0 (  0 Qp0 $ R 0  `0S 0C8S  08J@ 5R 08Z `0S`0 R , R $0DS 000C#,K4Kd:#;)c@9T9 -LMr@׫0S 1 Z0S00峫X] 0 QP @V ` 0,0 Q0S00P t@@00 PRXJ D "Y  9/$!0S  0S V 8CR0S00 S00 0S ,,0 tr00CS0T'PV(K!P 8CR00"g)cĹ9gx9;l9 -@PL` pP  0hZV6/ 0")c: -LM08`, J|pP4 ( 0 $ 08JE00C8S0}P4K08Z,K ;; p-`@L PP  0phA"p脻9820P#/! 00"8Q#(/p@-(0 S<3(057<@ @00@09780<S"p; @@0@008<<7P`@ +7P`@ :00;@0$TP7pE-`p0S S \^V P00@ @Q u00 0 0S`Ru00 0 -LM80PSD`= tpX98Y (@Ġ 00 ,0 Uu 00 ;@ 00<(K sP020P`00 @$"X W Y 4POT 8SD4K80XW0  0 /8g(ggQ S 8Q20 R  \  \ | 0 0/0|  /| 0!|  R  R | 00/010|  00/01| 0  0| 0/< P/0S/ 0 S/P/}c -LMP@P`p0( P@ P`p $KcȻ9 - LOp3 0-LM@KP K0 -L#P<0 R 0P 0P R'(g -LMp/`P@P (KP=; c0K   00B0 S=?( K Q02\0A0@T (0 0 S @ P) @TX \ 00  P0.Sa0I0Sa0B0SW0BX(g9:9 -L MPp`+ ((0"4#220 $04 D,KޒP 0 @(K, l1Pl ,0肦P 0t ` ,l1 ,V0<  l1,,G p9=jedAL9$9 p-LM(PK )PKp(0[S  00C0 S00•0S@`Q @@Q P10}c 0-0L~M@Kx Kd0kPP0^K0 @@0@0  K0XS QD0 Q<0 Q 0,03/K0J H 묧ch"q-9,:x9 -PQL`. 00S`S%p0@T@T 0S P00SxP020$ 0440apCWPE@g -L@P T6P0@T @T 0S$(@T#ļ9gؼ92: -LMpx`0  P@T $0s (0h @TU $1Pl RP =200''00000SЇh 0#4PP0 7@PK$88@#D0a'$B: ,0KN@P VPPpT00S 0S V 0Sq 0S\ (K R 0S(0 @ <&P0&0T0U0SV@T@T 8@P (0 `$0s0SZ @pPP000  " 40 $ 020$ 040 0 夥5 00aP5 0MW 0S  \|" 0#(("#4@!| ,40T,((0 "4#Q r  ؤ0R4  꼤p 4 "88 #$0a0""p X4 `"88 #$0a0""@GpK4V (0Sx  r@bgP\gᦥP 0u03V0STU(0K@E0^*S@ ,K0 PP 0S$ `X3\T#  L0 :@*g]$gnP X,0S] S7 ,0@"x刢0VPPp0,K 0N@PwP PaHr 00K+P 0,S0 0\ ,@0 Z@T@T $0s (0J@TlE?SP , ((0"4#220 $ 04ă\0 l 90 !1KPpW (0 P @X5P @VPP,@ 0 k|(g0g għcgc9p9;9cc`9i$992:99P9@4:м9 9:09,9d:9(9X99<9 ㇷ 0-P@Ly,00S,0 0h^d -0LMp80 < c,00Cs,0a 4K4PK`d0,l PU`QMJx0pL1 Ppt x0@ =9@pt =Cx0d0Y*<0S /PP`P`80 0@80<@PPT`8 *s(K /HP`P`00 0@004@HPL`@0 0@@0D@0=@P` L?B̽9 -鰀L0`S Pp@0@S 0PSp0SP`p@00@S 0PS  0b  0\ncLPcncZc -|0L0@S 3/e/㝵 LR 0@00  0 $0 BR g8g(gg9 -L~M@ {(0 0 (0YEKd0K$t KP(00 K\r(00(0 -,@L5T(00(09 p-(0LP`E e ~PA X00  0@P 0 V P@$ ` P 020$ 044$0$0s  P@XP L0@00Sp3/p,(g8ggy$m8g9 -LMPD 8|8#@<"p 4 `0 ,  "2,0 00"  24  @0 a0, e/1*\< 0S!  0@  i0 0D cD0I  Y4  0LS@0!*P: 0E40R\!: d0 R00S,0R0#03P0S<08  , 8 0 00j0 @R , q 3P R] v @000@0!Pb (K@4< E>* W?: R e 00 R0S8,0R0#03P0S<08  , 8 0 0@ 0  i0 0D cD0I 0Y40\@ * W %0 :4 S R!*0 80@< @ <0@4@< 8 0 , @#40 8 , 갾9A-(p@p,@ P$`(p,A -LMpP`@P    0  K -LM` QPp@:0A @T;P  \@  T=: U 0  T: 0U Q ,  0 U: 0S)P0pe000 0P T T0S*@B0ep0 R000 g `#鰾9 0- LRP00 @P @T0@E00 0h螪 -LMAPU^, p`C ZQ  ,0FS@0$P(` 0@ F,@ ,0 0 BS0 0R 0 0 ,0p0  0000 0 (KPP- p 0S00P0P00   0Z0 0    oP ,0@p @Z  !@c9Rr0S`cm ሩ P84P  Ag@c9Dc -L@L R 00CS 0 $0$ ,g g g p-DPL`  00bO 0$@ @@T@Cp -@L 4 R00 0S00h, g -1Ls@000 @00 D0ݕ 00@,)cg g 0- 0LS@P0 ȕ0  R 0 QP R00 0S 0h0 S000000a0 p-1LMQPL t1Q! l1Q d1Q` `p 1Q+ @1Q81`  p0`00(00  p㛭`P KQ`P@ R 00CS 0 00` _0 @aT0` @@pPL H 00``0000pS}flvt~fwt@ ggg -p0L R`@w0 D@00000 U0 g$gg p- L@`A@P <0 S Cp0<@pg$g Qp-L@p`0 PAR  Nx0 0 PR0 R H0 p 0S0SU RUga0g -\1LHM p@P廔`4\,,! 0Cj`P  K000^0^`@KA 0  ?P1?#`P`\  0Sb 0b Q@1 @!T `P0Q 0Q`#`g g9:ܛ99 -LLMp^` 0^P0`@K@ 0P ?P 1? #0KPDP0 00 Kcc:ܛ9890@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R00 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R0 R 0SP0U 00 S P0@  0 S@ y -LXp5 PU?P0S`X`V  0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` -@LP ((0S 5:\ R0P 0 \:0 0/P/((0S005:SP//P/( (0Q 0#03SP// P 0S/0S/P/0S/P/0S / P 0S/0S/P/0S/P/0S /P/Q00S/Q00S/00 / -(0@S0(0 L 0x R Pᑐ, RQ000(0 0 , R 0Sዐ00CS0,Q R000 00 ,Q 0-L8MP@kxP\00S 000$0  R00# 00$0$@ QA$P Q& L0 80C PL0 @T |1|!0t!040aSH$0S @1;K00001Q 004 0$00  0'lLK$@ P# (0X 0T:d Q00000$00$ $$ ؏ d )c;g9n8̿9 0-L M 0@02P 00#^ 0#^002(3x0S K0,K0hDd (0PDg9n8 p-L$ろ0`@T! @T 40R኏P 40R PU |0| t0 40 c R m @Tᗎ0 <ph^D)c<)c)c;gt)c p-LMP0 K 0  ]@T < 40`Rp00 V @@ @ <04 S`H0@ 00bS*' P R0000  0 M PKp -4L❡,0@T  @Th襡D)c<)c p-`PL@ 00  0@@ ph 0-PLh 00CQ0& QU  0Sl@T0ߎǎ@T0 0S 0 008T@T0 0S0J@T0D)c| rd  d d0  `0X0  \@T \00dQ00(Kd h  R^ (0K2h0 5:Ra x ,pM\`Ph@ X0U  SL  L d@LL dt `L @bTZ D W00 S 00 |  @DTXQ Z  D W00 SX@@ |0  tP @eTZ DW00 S000 |   @Ddd d  ] 00` X d00d0 d  `Vz-@Pu`X@ u` @ b` p0dd dYd  Vd0@S 0@8CXo@1A h>0 ` l@Ph d(Kl 0Rh@h0000d( K(Kch@  d\`P\d1d .d @+ 0@8#X`@+dd d@ 0@8#X`@lP P?Kh LP ?K`@X` 9X Rp0p X p d00d0 {0\` p@rd) H `d 00d 0 d   X X0 pdd Up0+X Pp0lPdd p0 d d D@@0p d0 0d0 ;0\h0 h8\Q@h  \ P h \0PbU\PL L őd0 m T P  `  0S S S`P@T0?K0(@+@?D Ru Zg D W00 S  | i @0P? K@h LP ?0K\pd @ d 0d ǟ@xX P` H d @l ]d\ǟ H bd d0 d@ 0@8#X`@Up d00d0 l00Lp!0000L Qp l `0 p*P 0@ \l \ p00P!0l 00A 0 \?\0 p 0@P`@0@Po@0@P`@ | @DAD@W00 S |  hh PU):h0Z| `L @bT:Z D W00 S000 |  @D0| @D%0| @Dd ` L0@cTZ D W00 S 00 |  @DTP | @Dd Z[ DW00 SF |  X| V U) Kh %(0Kh0 H  %2h >&BbP`h (0Kb1(@K 0EW0 0d6WQP` @Dh@ h (K00b0 P0@P`@]000D0S  Rl |@ . | 0Bl| =d d  d@ 0 8#8@T0 P@ 0 T P }|  @xQ pT0P@0w `Pj  P@ l@2A \@QTK<@00` !0@0^S!0@0^S^<,Z9 DW00 S |   !0@0^SD@W00 S |  !0@0^SZ| hPL \P?L0 P@T0?K @I| PT0?K =^ Z DW00 S>00 | {p 0?@\0 p 9p99999d9 -L@MQ  K" 0( K 0 K(0 --0 L M0CQ0  0( K  K0 K( 0 0-LM@TPˆ 0P40@ R 墈0V坈0)ch --LMP奈 0 e,0@ R 僈K6)ch -@Ld: -LH : --LM 0 7 K --\0LMl!D0 41 Q @@ 41  0@K=j 0-LM@< +PK0@ U+[P @ P> K0(4: -p-LM ` 0@PP P900 R0PP Kp g -p-LM@ `P 0@@ @,0 R0@@ Kp g 9 --xpLM0PSd0 P `AO L&P 8 1,@ 0@Lh)c92:&c -@0 L$ 00CS9)c9 -LM  0$9@-0V0S  c1#88 0S$H(h$$$$$4QT"(1 T0`!10 0 0c0C1 0S/0cd0[:i0h0h0h0 @dC"Qp0 Lz@@u8r)c;)c ; ;9 ; 99999989 -LM40p,S0 @h, 0' 00 @(r 0 P (r @BVW 0Rq,eQ sQ dQ ,-Y h00T 0 SX@@A)c)c; ;D9 p-LM0P S S` S S S S 0 S S S S S STp@K!P @ {p0 S S p\99 -LM R R00P R R P R R  08 R R# R R R R  P R 0S@8@!Cx`0 08#h(0BHTP0  j8P#800 08#h(0BHT0 8CHt Qs (K,`K!MPs eb)c;9|9 -<3L M `RB$SP93 P8CxnTNT @B@P 04 P00 004 #Hv)c)c ;92: ;9 ;99; ;;99999 -L8cY(Cx02B  $"0`S/ @P 0PS( 0P0  2PW WV W0S (B(00R0S xPc0ISF$ % % %%PQ0SD@0@S PWc0IS%%%p%cY0   0@00+|00SS P@~)c; ; ;9)cD9 -LM`p (|@0 S SPP S@S(K,K!P0, R ڜ?P QPqP |2p 0 yP,00aZ<f 09 h)c99; 9 -L0MȠLK8 LȠ`CxT c#3 Q W ß0SأP @$0 @S P0  3$0PPS @U ,PKpa 0Pk,@t H# T0(i PKtKW,0sq aT,",p RP 2"PP@ PE U @D2 |B@T`Ÿ 8C8s S<2 P(2\ 8C8s S1 PP!001 R$ @p 0S# 0=P0  P0S S0WpT(KH@,@P0S @P 0S 0P0  zP0S S0UP p0@S 0S 0P0  [P0S S1pTA)c)c;99;; ; ;989X9 -LM0 S SPpp0 S S P S S S S  ` S S `0 S SPᄆ0S @@0S P P@0S@ T T`` TPz1 0 L B*R@%%%%%%%%%%%%%%%%%%%%%t%%%8%p%%%%%%%%%%%%%%% %%H%0 S 0` 0$KT ,K!P, 40 T ,K& K(0K@P,"[2[?0@ T ,K!Pt,  RR@@ R{P40 Tk ,`K!@P,D0@ Tb ,`K@P,d 0@ TT ,`Kq@P,e y0@ TB ,`K![@P,@0@ 000 T*0@ q$4000 T? C ^000 zß#00s03S0P000 lK000 gT0@ bA000 ]<0@ Y80@ U`20@ O.0@ Kt*0@ GQ000 B,`K!P0S ,0A0 0B0 RS 0B0 RS Rt R R R !P,00& K(0K@Pf"[2[,k0@ !@P,0@ !@P#,0@ & K(0K@Pc"[2[,G0@ & K(0K@Pre"[2[,70@ & K(0K@Pbd"[2[,'0@ )c9)c)c;9)c9>:999H9`949$99 -LH><(42P(P =ht99h9///N/-// 21C/LPc 32C/Zcd0 $\/H0 \<0 | (0("404 /ncocnc-0 $ Rl0\`0S  Q 1S0Ġ 8 8#$ $ ncocnc/E/// -LP@p`PV `P@ -LMR,0 pP ' `0S` VP 0 S00űq@P 0 0 00 0 00CS 0\q,0 -LXM`Hğ0@0P!Pt x0 :R`Kl  0P ` Kl 1tl p0 Ph Z 0l 10 ("( P  0x0Sd0 p 4KA40Kx, 8#pQd 1#e(0@p6,d 0S a$| "0P  !$ @$ !0l Q0SHx R 4K4KQh X0a 00S7,0d Wc\@ < 8 e<0SY1! y$0@@ !0S z0  !| @ !!F 0Eh zh R 0  !| @ !h #R r2 Rt lh l P p jh(KW0R,0dP00Ӕ@ 0R@Km0| @ @ < 8 0h0 tlPh l 0h0 P$;ɚ;$ h;QX9 hʚ; -LM0@S`p 0PK P K߿P P $PK P0p -LMq0 Qd0_BSeo0F$Hp/Q 7G$0P ,` (0 00K$KMb@B 0-,PLP@0PP0UP H 0R0000 h 0-@L =yP008#Ƞ90PP00 xH 0@R" $0@ 0  !$ @$ !0hy`` 0 00D ]0PP00)0S - h$ h -L M< @ D H 0 , 0 DH00Z8 40 782a070`0PpC @@# Z!nPP . 0,0  0 P  <040 !<0 0! ! 00CS 02o Z,0  ^, 0 <0 (Kn8 -QL`MPt x |0 @c0t P0BZt [X@K VL0KHKDK@ T`KPpK`0 d h x R   g@P|0SU  ^@PO 0  !$ @$ !t@ #T Tx0S ` P@ |\ d  P@P h P@ Y ! B 㧊(K  0^ 0 0h X K ` p`0 d \  @PP\ `p 4Kⱼ40K , `x"pQ\ 13e8\0 \0@`6̌p\ P Ϥ l 20p0 0  !$ @$ ! ` t0@Pd0S` R! 4Kn4KVE W0> 00SO,0\ Vc\@ < 8 B<0S6(1(!l w$0@ p 0S Bx@J0  !$ @$ !F l0嬸@*xT V0W,0\\00ӷ@ H0R@Kbkl 04 @ @ < 8 ɚ;$ h;Q`9 hʚ; -L M0@S`p 0PK <P K~PP $PK +PA p -L(M0@S`p 4PK P KpP,04K#!B ( $ ! (K pb -LlM@Qp1 0 P  T  Tf 00CS 0 bm (KT 0PK0  P< 0TpHP D@ 0 4 ,0 8 p8p 0S4W10p8p 0S+W) RP0  H KP80c(P`pǏP @0`0@(P,`@0D@00S   80W pP 6P #P -LM`@Pp lP  0 0 0P p_K -LMpP` l@P  $0 ( 0 0 0@(0KP@ = K -LM@p `blPP " 0S 0   Pfgfff-\  )0h SS\0  / h hR  Rx0x0'' Q Qx0x088 R/A⸴ -0@L1  00 ( 00Qp00  (00H >1>1>1t00  |0S0 0 0l0$0(Q h h p-QL M@`@00CSK%@K%LK%XK%dK%000 P坧@Kp-@p0h0`0K KL0 20@ @ ׀ h h h h h 0->PL U@:h0h `(h \Hh Xh00 \ @0H0 0@ɹ0 U;h00U:h0 h hM% 0-LP 0N@P0.8CR0 -@L`^rmVpH l10RUV hp t0`0t00H0U l10 XH n n=j;9 0-@L=mt0P0t00hsn p-LM@-mP`H0St0t0# 0  0S 3/H0St t  0  0S 0t0H 0uPP =np*c p-`DLp 40l#"B PlH L00bO 0$@H >RPPnp1P91pZc 0-@DLp0 40#P"B Pl R00 0S000hmZc 0-@DLp0 40#P"B Pl R00 0S000hmZc 4 0p-#Ll"B @`!r rD0P@0pD`xl00@mp0P@0Zc*c+c -LDMP(Kl3"1L3"1  000c(0S |P @T ,Kp`@T 0KV P 0 ,0R:, p@`TD0l<0<K 0H K,`V4h2h0S40 <0K 0@@<0 8@ 4 @ 20S@0 iQr )0h SSP, Q )0h SS\0 H P ,0R:h0P,0 Q)0Sㄡ S| dt1Zl1l4<1@+%<> ,0ϠC/@nDlb  <@K00H@K0 @P` ZNP0 ~0 ,0Rzk:D0huP,0R:$0 hH0K 0@H0 D@ @ T2H.<*4jQ9@KLɚ;@999'k_k$9999 -@Lt0 | (hC -.H0LS@t0h0t0H1. -t0L@@0  P HWPt0@0t000S3/Pt0@0t0 - L X_ X X X - X00"# 0@d 0 d HPT#0?0S X%W%Y%W%Y%W%X%0r8#(.a0HS H0 `0HSsY%0Y%0Y%0Y%0Y%0Y%0Y%0Y%0Y%0Y%0Y%0Y%0Y%0Y%0Y%0Y%0Y%0Y%0Y%0Y%0Y%0Y%0Y%0Y%0Y%0Y%0Y%Y%Y%Y%Y% 0 .0Pc0>jpH x P``0O0@d  d k>V0 H>{  0@d 0 d  H P 0>eHb 08#(08,!#8 Q0A8#(}zA0H\XSNP 0@d \ d Hp Pj ;^P!P(P'P)X)P0 l 0@d 0 d  LHN PH>SB > hn8: p-LP@ jt0`   U nPkp0 Jkp 0-t0L   % P"20#0 P0S0 0@@T 0h@T00 P0S P ^T @^? -LMPP  i(`$pK @P $ @P` @P $ @Pt0:t0j0>0> p-`QL@pPd aP]Up -LM2@0 SP50 ^ B?@0CS+1 ? R  t0 ! X0N>O2n @ :t0\ 8CR4it0 :t0>%`(pKⰎ >} PP ( M PP0t 5*0t Qj.8C8Ac Q.PPQJPUZn8X9 -LM0pP,2 8" `4r 0r ht @ 0  82$$$4M0 j02S 42S K]0(Kj#0l4 R VQӽ 0H0S8V` V(ڠ\#?0@ @V; .H j .` . 0O0@d P d `l pʨ0H0XVQӄ 0H0XvhH0@X8"xt0p"0t0h2HN8P0`FpH0XVhH0@Xia Qp1|#K  gP0 p!`04"R S4"  10S  p0R p>SW pѥ0B @Q Q Q P1MW pmD \ |0PY 0V @T00!P1FM0S-  ƛ 0@rP0 &&%4i42S,"Q#0 'i 0" #i# 0" 4Ko 0" *c=jn8 h*cgd?jg*c *c p-L@Pg` (Q+Q%t0 >;.t0.]6phhp0t#40#"Bp0t HQHP q0 (- Q HP& Zc Q-L@ t00t0t0 0t0 0) P P ㏙ -Lt@  0R'0 t0! 0)P P kxQ  p0̌#40#"BH0t 0t0.hy h h -| @0S00L>0 Q>|  00CS0 tSt@cpg -`pLp60 㨀f@g  0@D  D 9@P ✠% !,t 00S s PWP|@ q 20P<j t zRxW  a @h0(PTg ?R\(0Sڜ0  P HJ Pt0@t0 0S 3/Pt@tt  p [ t|  0S- 0S  0S 0SI 0SW~ X3| 㳙t p 0@$  $ i0 t@0  th0@t t    0R50,50t o pG0 #Y!   A0GS p0S P 0S 0SM @T T   *t@(0 h0S&  .H0SXtp  0S 0SWt W W@ p p(0 S|PPyPY T 0S 0S 0S >08#8S>>>t  ^>0SpSn l >(B8CS@1@#Td@DT]0p  x t  (Wt{pp !W|pl 'W`pi -W XH0|S W 050;5(0 0S050,| 㬘tWtW   ^tɌt z Tx 0>(!PxW 0S -4tWW9 tl 0W6tW   >Rs kQe0>t>tW  |@ P0 P p p P P 0 @Pp0 P P W 0@0S ttt/* W   {t}\Wˌtx?op0̌#40#"B0t )W}p ^W~p % R @0SG&| חz h h hn8Zc p-LM4`K@P0t2Ɍ0tY Pt09t0Kp -4LMl1P40 p0 < @ 8p ,p 㨠c@Ze0 4 0S\ c@x4$,$?Aas  R0S Rj8P ,\,0 8 0_t 0  @0#P30#pd8\ 80#p  0S00SW#W00o㨠pc@ kd0 4 0S00D |0P 000!4 1@@0S  |"2@pPt =(0S(Ÿd` _@P%0T: 0TT X<pP< 0S X` T 0T 0T 0T  T` ch1@/ b\)Sd8P 8 v(KT =  S| V  !1jpP 0RBʡ#W  \ 0%=0S8P+ #v 8 88 0R,0 80pd#ppcp=j;gfff*c*cg*cU% -0L@  (0 P0S0(   p-PDLp# 40#"B `b@ $c0  $0Spt0191p191pp 0SpZc 40 -LàLP@UbAp&0`  VW ct0`.H0S` frc _ tPʤ0  `t0`Zc -LxMP0 U`' J:U# :U 0U :U  F:U j:U :U 0Un :U' p(K:0S4 0 S D |0^ @001F0S *:@9pP 9U'9U 9U9UR @0CU 9UX 0Uat @  5,0t bp0CU*0CU<9Ut 8U :80Sa9 0S$0Sbp8UI p8U 8U 8UwH0p0taat @p0,#40àLl8t  P Hh0S Z t0(0(SpS PKc@ 0P@A0x0 t@ @pPA pb(!0p`pp3bpKW/7Up X7U((1 R 0A 41 R~D0{ l0D'20 p$7U 7U l0p0Q0CUU 0U`t0p;t0'b\6U? 0Uv41 Q-D0* Pp 0Qp| pH&0Zp pp  p41 R_ xP|pPp , p 6p ip`t0p;t0a@  P  | Fp@5@ p`Tp#*l0S w`l0T20   pP   l0 anpP f41 @T0S Rz\ 00CS0 4! 0004! 004!| 41 0 !D 0 D  !p841 QuD0r 0p ,*`x08x0 @8x0  x07x00@x08x00 x07x0d_0St0t000t0t0Y_A? ,ap_@ 1"ap(0Se0S  3/pPyt  0    00C 0 00003!0 !00l # B,0 000-0S 0x 0 QR BP0R 0P R00c!0R#<0,c-H0P R 00c!0R#<0,c p-@L^`Q@# 0 R00B0C 0 0 0A00P0Q  00b0<^,00\00S0 0@_p 0-@LPU^0S US 0S\ a aR QPb0bU00S0 00hq_000 0 -@L`&^p^P V  0 PbU0PbV_ 0 b PP 0eS0 1S00PS0eS0 0PS*_ p-@L]0`SP!  0P0Q  00b0<^,00\00 0S00000CS00 0^p -PL`]V@.Q@*pQ% 0S a0 aR@@   P 0ax0 0S00`dd0Vp@hQ  ^ -@LP > tpP 0SB0 S B! >cp000 p-@`LP >pV`0 0 0P  pUB> }p -pQLP@p1)] Q( Q* `0Q! 0P ` `0RPP &`P  0a 0 0S 00pe 0W8^ R 0   p-LP@\ `R4 R0S) 0 0 0P \  a 0 10 0 P000  0]p0 #0 00  V0]p -LMp\0S" 0S 0R ]p$K@@KP@K $Km]00l! D0 41 P \/=j@-D0@ 41 0S  0@[\@ p-LM`PD 4 @T Q Q0 S 0  !D D !Kp`\at -Pp LD0` 41 @T  8] 0[`]` -Pp LD0` 41 @T  8] 0[`\` p- PD0L` 41 @T  8] 0?[`\p`p , P/0S/ P/X,c -L@PP*0S( BT4P: P0-LP@0P QT 4Q08C(R0S0T0SR\ 0 -h0LPpU`@T * \4@0 Y0 Q 1000H hl,c, h -0L@T`PppP  PT  C1 @@u  0 -LM`P PQ@ @ R*@PbTp1e#Zp pP  0j0  - HHZ0  0 P0 pP  rP'00h00,0 Z  0j0   0   P@,0p0/p -LϠMϜp0 zQ10 K0 6`Po W0,0 ,@K`HH0@000|00W  pl 000 S0`00 WDV@ @PP= Z% 00 0bW1! % 0S +h &W1! 0  00b\! 0 +  Pd0Wp00 W,(K,64 2ʚ; 999 -LMl -LQӷRQ`pP PP 0 \@ @ 0S*@cTS5X V 0!0 00P0000f0gPP" 1 `000 0X0j 0    0S 0S00P 0PX 5 -LM Q-Lp@`;]W 0 0g 0 1000P( 1 Q PQA @@A10 1 4 1H00 0g0 `` ps`D9 -L@P   -L@LPLpL[n <0@{T0hth(;,cH h -@ ML 0@oa0< 0@]O`嬠p嬀P0@ @#5  0E78YP_U`85$Km`9H h8,;h9hh`cx,c0;p9X% -PLMp,  ,  0Q`%,` PU0 Rpc`NP@P V U1V   P@` PU0X/@gT@!  0X# P X`p0S P P0gX@c]TPP PPP X XP , 1 0Y ~17, 717 -L`RPp*Q+U! 0Q*U 0ScPPVU 0@`T@! 7/P`dVP:85 399x99 -RLMp`0,0 PP V`:,K⸠,0S PP2 젠 iR",0S W gpZ @1@! @`d VPt0Z0 c+1,, 1:1,Jh -1L`Qx 0,0Ss* 0Xcp`!Q@@T P 0H T0 Sc:X4`X  `V00S 0 X@1@! j d 00dS 0000 X  V00SR`` pP T,1 Q PQA @@A1 0 141H00X@@X 0Xpc` A100 202/2/RP/0S/0S/P/00/// -LQ@ 00Q02h - LR0@0 0S008h R0 0 R8#82h 0-@QLP 4T R$YPP@00h 9 0-@ LPP 0 -@Lp`@T PU00002 P02@T P7 -LMP, 00 , K@P P P X0PTP0 ,pRW \ 0`g 0%`gX00S Z,00 0(KX#VfWf0PUSUX  0 `Q ,0 0P@, R  0 R0X7\pfDX2PP00X00SU% `0,  0 0f 0 00 00 0I00P0@,0  1 m@PP  zP0 WU' ,0S 00S VU 0S:0f 00, ि 00f 0@,P W 1g 00 00 0A !B89 -40MLl @   0K=j0S R$  /0S$ /0-<0 P @P @$P0  191# 0/#R00 80S h0 ?SR40S@-<0  0 `0aR  $  1@91# 3S @ 0 00  80@S @0@ ?SR40S@-< 3O 0$@P/ 0-<0@L PP R00 0S000S=0=0hQ 0-<0@L PP| R0|0 0S00|0S9090hQ 0-!<0r@L  r00PPD0D0@0@0P,  4,@04Q00P@0-c-c-c 0-LM@uP0P9@ %@ 80 l 0@QK0=j p-LMP@TP@0`l 0 @QKp=j -LM0@P`-@ K2P0p 0  8@fQP,0Pl!  0@=j -LM0@P`-P KP0 lP0p PP 0S000VH 0V`< 0V003#Q Q `=j-c-c -LM`P@O p0 @QK -@L<@ D0xh -$LM^P` 0S \  000V Z V W@3=j! -P@L0S 3/ -LDM9P@@09P pM`dKD ӻD !2[0980|0N0 00S H3/ K p-LMQ@P ` Q Q KpT $ 0l 0=j -QLL06⼅h -0@080L06⭅h -L MP L32C0bC^ (K a3#0Sʐ gP 0@0 40  8 000%T400  0%000 00 ,K 4 0 *pP,00  04 , 0 000$00$00  00CS 0 8000S8606S00,4 K00H6*c~f -LMP I p0 < 4K`P (K 8K0`P 4P , S,KD K=`P 8P  S, 8#H@,0 ,0䁟4 ,00K @ K<`PL00@0 0000800 <   D 000@ 00048u`P(00S DK  `P<0 4, $00$0, 00CS 0& 0 $00$00 00CS 0 XS84L`P @u50 6080 Dm5,6040 05,5,@0\P06F@ P^S@@2?T~^@@P09 -RL MD `@ 0K cPP, KWPP (K=,< @0(^0[ "( 3 3S P^  00C ,p80 ER,K4 K;PPS0 :QR\@ 3SMN0R4j4,5?R0) 0("( 3SP*0 $0F6"<PP <> 00CS 0 4 904 000<> 0P0CS 05 5#0P3R6} PYPO | =, 0080, 00,0! ,0@ PD PP00R00S(U Q43,4Q@ #P5P,08 K0, $00$0, 00CS 0 40 000@SP,4 689*c~f@9 -LM 9@0 @K -LMP0  ʠ K p-LM@ K`OPP p0  P 00CS 03p -LMP Kp2@P K 0 `  0_@P  00CS 0 3 $K0'@P$ @$80S / P 0 Q/t-c 0-@PLP0Q 1S 0 SD0 R0S0 0C#1S5/@T0P/d& p-`QLPp@1@S P4 (0 000(   ( TphP 0S  09 4-c -QLp` \O@` # q0  @h-cm8-c -L0S0p0W% 00 RP`@`TP 00 0Y P$00C$000C0U3 R! NpWPaPQ@0T0F (0 ( D@T@Tp; ( 00C0( 0 (0l5D@T ( 0S Q $0Q p( D@T0SW @T D@T (0 0Hl D@T000pSph-c|h-ch&d& -L M` 0PS4  2R `(K Q 00\l2 A d2!\/0@!b0S`0p1v N @O+t1j ` C 6N  @l&@T X 00 `ӹ 0 0PCp0K! 0sO 40@,pP0 @0 pP!  000Z@  4P @WJ0 1P51@TZY(0,0 7 ,NP @ P$0@0C$00Z0C0 A 80<4  @@<0 @,N0 R  !$M,(K0,00 N( , Z4   2=j|h00S S/ P/P/ 0- PLU00 00S S S0@@0@ @@0@0h R00 0S000000 0-@LP0S000 gL 0hL -@ 0LR ) 0S S S 4س TR00LH9 -LtMp0`S/@ (K iQ0@0̗jQ@h XP PKcD 0P@<x0 t@ @PpP0S&@ 0"@(!08@PTX 0R)@ 0 / 0=@pP   P  0 (1( , (1 0 0 ,((04 ,0,(0( \@ʚ; -D LRH0@H0H0  R 0T00`# 0S 6*P 00 L K0 R0h|hm8-c -LM0S@=0C hR8PU/@1٨hP`/ j0p 0 ˦@ 0PK0c0 @]<t0 p@ @Pl@T hDKo9hP p!"D0@$K@<"@K 00 0 ˠˠhlKD K 7@Pl0 pT0(1( , (1  0 0 ,(4r9 0-0LSP X0S0S" S S 勲0 P0L K@P70P8@>{P0SD0 D0H0@H0(0( P 0X9 .c.c-c.c.c - QLPp`6 @W@ Q00S0v03Q0SQ=#&#&#&`#&#&@#&#&#&$&$&$&#&$&T#&#&t#&@#&%&#&l#& 0S -W Z - 0Sm , 7 V8R0 T0 02@P  80@ 0$@80<@,00@( @ 4 00 @5T'0(B8SH S& S$ 幱0S S S 就|z P P0` 0 {o圱Pj0 0 P= T@=RD P`0P 0 ]@W@0Y0J GX 0S80 P  @QP 0P7X %@W@0Y0 P90 P P7p P p|9tht9l9d9-c00300/00#/00( 4000 %0 00300/8/p@-X0X (@HPP`X \ $,@LPT` (HPXphh0/hA-400 C6pǏ(#"B00 P' 0Q 0S@0@ R$0$0$00 $0 P`PU``0 0P`XP@`0d@00 0(P0S@0 @P0S@hhh -`VpL& 0TV\% 40 C6OPU`` R$0$0$00 $0 0 0$ 00 $0$0$ $ `UUy9 -400 C6Lpȟ(-00#0"B005000 $0 (0 @0P`P `0 @ P` 0@0 0 $ 0p@@`0 0@`0d@hhh -3X!2CL0M,0 XG PQ0000 # D0s!rGp(0P` P ` 0 @ P`N0 0 $ 0,0 X 0 R! 00 Q, $0$0$0$0 $ 00(5000 40$C6Q0 ɯ(, (X(Kh P-Lp`P@P@DTPW -ph`L@jP(  P@ $PpWh 0-@LQ500P 0P w00  600  00<00000 0@P09 -LM`@P*5Kp<H@ DP @P 00 @\6K00/00000 -00L@00000h000006 -L M!0 C6B6cO`p`VpࠁQ 000S @d _,0I0AS00L1P&O0d P9(qP03! 00a&0S0@00R 5 .0@ \ R00C10/0 @L Kd 00?2c, dS0d00OcЕi$oc4;8;hh,hhh94hhhhQ 0-LQ0@0 P 0@P0 0hh4h p-@LX400` 00;0000 A 0S `10S 3/0000000P <Wz00   0S10S 0 @_Q t0S'0 0tphW50S*00800t00:00000 00800t00tp0Shhphhh 0-00L PM00\<P00 h&0S 10S 3/00 *   00  00  00 # 0 0@ 0$@00@ 00 0hU008000ht00@000|000800=(0 0@(0,@ӭhh9 -L2Ll!D2 3p4WC Y 2 0PoPVhe pP1 1 0PoPV2/ 400 90S 00t!0S  3/P2E4!0*E3ypP !0S: !0tUt0SY00S0p R3Ƅ007003 Ut0Sʓ40p R4 0S 00s=j0hhhhhphlh9 0-00LP D0#4 R21C 0Q 0  0 00<000hv000002@4$ l0000hncLPc=j - LRpg 0ST0(0 P00S $0@RQ XE t0 0@t0x@4P `00 0@004@ $ 0@00<0002P!0l  0H  H 3008004\P %X@  @Rd0 0@d0h@]@00h=j -LpL0PS` 4@8@ R @00 00;00C` R 5E00 h00800hr -1L P@@20@ Dp@ `P 0 @_R 0 P0OT r m.3p0 R$0S< #gSt0S0p R,hh8;hhlh -SL M40 0 @1 , {`P CP0D0 @P40p800P  xPtxlp0 0 <P\@ PR00 @3`4 P00,4002(K12삟 , Po0PVFt0Sڴ22 RF4r>0#6Po ?QP@P8 P <j0OQ t0Sc!0 ?Q?A!0r,m2pI r11 RP@P0 ?Q-X1X!l0\ H1 \ ,q4A4!000@;00000Z 4`噢,&2p^PUkP P0p R80p R^, 2pC0 @4h!Ce.chhhh8;hh9lh=jTh0hph99 -L@ 0P  -LMp< 00 & 1 0PP0K` Tp P ePP 00 00 8000l 0~pW t(K04KH ,@K@0PE,04 @r,@ TWP<  0sCPD < PR/J D1`PU'J0O U 00HP`F<@T D1P @00;00 < TD B0 <D0\ 1@ > D8 1P(`80 p0@80<@(, T10 /00040K tx dP`0`4p8p0H08 8 0O`0@8 <d0h@@ R0 40K)D t0x@0 0D|00LP(` 80X0@(, 80<@ 0@ l000600sK/h9&=j p-\0\` @T0TLP0 Q00cR0bc00cUpp,h8;hp-00H 0R00 P RT T0X0T0 P T0H pP` P`H0 0@H0L@pPt`p/hh 0-4 LRP@H00a4@0Aj -LMHPPp0 4 4~d`40PP, d PL 4AƠ 40@CƠ /P00S@P0T@\- 0 vP`d0 `)044 S 0 ^:000 H0S '74AZ0 R00300,(K400P3A00/P0 PT `40dpPc, AjhOc -LM40PC6/`0`,0 R0dp`0dPh`/Ƞ6@ ,000u00@0 @0 x  P00@P0T@4 0P@B&`?S 00300R00300Qh - LM0@0@0 0P dP 0 0Pt*6@P`PP`0@P0T@P `00300$0 dph4` اthhOch9 0-PPQT0T x0T0 PT hp0 0@p0t@H@0H0L4(a00 !0hhAj4h p-H`0VLPH0 00F4kLD`0S -Vp00H` 00000 R600500 RP P0P0T00PTp0 0@p0t@pP RT0T0T00P T0t 0p@ pt DH0 0@H0L@00m Ajhhh -H0LSP 0H@ pHL Pp p`T 0@P0p P0^0pt 00000pm00000hhh -H0LS P @RT T01T0 P T0 1p0 pt l!H0\0 @H0L@DD1 Y$*(!p00 @p0t@40#6 vP`d0 `R 4 _40CX:kH`@圐X2nlQtp Uh 0 `U 0t\p^hhh|hAj=jThhH90h00000z -0ML 0 08`p@P0ʠ @ @+PT0T` P'HH0P h@lP`p@tPKhKXHchh|hhhhT90@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S R 0000@00 R P,  R/ 0\00 S 0  0S0S 0P@ 0S@@0  @0@000S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \   R00 \0S0  0S R( ^ 0Sm R 0S 0R00S00 S0 0S    R000000 \0S0  0SR 0S@0T00 S @0  0 S 0R00S00 S0 0S    R0 R 0SP0U00 S P0@  0 S@ y -LXp5 PU?P0S`X`V 0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` P 0S/0S/P/0S/P/0S / P 0S/0S/P/0S/P/0S /P/Q00S/Q00S/ -Xp@ MLLPL`LX 0P`P@@@初Khxhhh|9 -Lp\ \\ (`VV , $0R \0@HP HL 00d0@@P P@D 08 @bP0#"#0%(9@` .cxh 0-00LS@D DR 0810  0  B (P X(PX0S P0Q 4 $0R PU00hb Q 0S8 R R:0.SR 90.S R$0$0$0`0 $0  <R  000 0   0  B hhhthh 0-0PLP (0@S (0S TH0P0(0@S (0S T0}{hh -@\LP p\PXP iXP 00S0$000$0h8 80R c/99 p-@LTP `P`@@T@p 0-@LPT P@@T0 -3LXM@l3@Q` 0S0 GKH0KKXP   0pW_ 4 $0R l3@P  @(KPP   0@00 0p$PW 0 T )060 &P0"0 RN S*@P060E d )060H2@P   8*@P0@600SW 1@P  ^@ 0 0 p @ 0 P0p!0 R$$0U9 @1@P W 0!0 Rm(0 0@(0,@ @) ` 0)0600@D90T  0@P  E`0@P @p> ,0@ P @ $ 0=j .cxhhh p-@LT`P@P  R0T 0@ PPP@p0@0@@P -1`LPpP0Sȸ帡 0R1P dW0p$0@40$0 9,0(`8宕X0S: XP 4m=(1PġW,  W @0@00 0S 0Rؼ0Pm8 RR:0.S `0  $0@` TX p @0 0 0R 90.S .ch;hhh9th@- R00 RP00//// 10S 0@0/$.c 00//@Q@- 0@ 0$@/!001 - L0; S 嫘h8 -$1PlqL0 S TP @T 0P )$0 $  Lk@$V T 0P P T 0S U00Q0S@kV<0<0 0ih=j9 p-P MLt 0hPP TgD0D `VPP@PS U$@Kp9h4.c8.c -@ LP( R,0,0,0,0$0 00g P -LMP,  @0=   0R 00P0 ^,0  0R q0 Y t/ W> X. WFʁ qp tq U<9 Xt0   0 0Su0000rtuXYTU0SVt0 TY t6 q: R Q W t0 00R XY V qrruuXuVzrQ9 p-L M0PK0%@ `K0S 0S  0`%PKp  -LpP01 0101 P`u 0P@`PU`P `400v0@0 @ -@L0X<00C0hh 0-L@PJ<UT0040P0T$0 0   R0h.c -0SL 0R& 08 p5 P` 0S@ 0@ 0p $0( 0S 0 0@ 0R0 @  -L M0P@T$pK `K$0   0`x@P ]0DS @p&p&o&o&o& 0 0 @K 0 @ 0@ 0$0 @ 0$  0@R  0S v 0 0$  @ 0R 0 0@ -L M0SPIJ@PN d @ 0@ 3 cHQ d0S\  0@  0S @ K  `V $ (0@(, P$0#0f0@S (Q,0, ,0, $ 00T 00F` pK'`@(K 0P ( `P |r&r&s&s&s&r&#@@T $0@P(  0S^ 00@T$0P( 0 0@(z@0SL P ( R,0,0,0,0$0 $0 ,0( P((0 $0PT& $ 0P( $0  q@ 0R:  0R& `P(0 @ 0@ ($ 7@(0$ (0S *(0S # 0R$0P( 0 0@.@'.c.c -LM40 1\l10 ,0 080 E\A0U@ p pppU2T 0 P9 ,Y(1; `PM@$ 0 p4  00 08 0@$0  8 0 ,0 ,0Y40% Y Y @\ @(K0@P(KoY0@1, (1+@ @T=j 0-@P M@L48 0P@rK0hbh9@ 00< 0c8000/ -LM 80@ `$0 R[ 0 Z  $"P|0P0C,P SP%0 ,0S 0 #xP  00W(0$  P IW(0$  0  R  0  ,0S (0$ ) #応 彜 99 -P804L0cS`p  508 @~0<0@ 0` `0 <0@ 4 i5400@;40 <j80< 0800<@ 0 -LMHD 0 0<0 D000 R0 L`80  S P< 40  H #X0/S  ` 0S/S@ 0S/S aR\ p!00S $\ (@b$0/S HH0SɌH<0SɌHHɌHR H ! 0U E0U 0,P (0P ~ #0Sz 0Sw 0 H  00H P0 !P` RHZH($0 jbH$(`0HSɌHP0 ST@T#  ! PH",K0 p Wa ,PHP0 S SMt30 S *( X 00SXP 8 X ` 0S/S@Kp@\ P0/S Hgjnj$(@HW PPH  D00CSP  {80SHs @T $X 0.SK0.SʌHFGSHfR < @0 0 " RN T, 00 (K0/S $0 ab$X0S p0S 8 0p03R0SHPɌH p@\ ? p!yH4 R4 (0$ /  z4! 9 H n40S (0$ 8 Rr (0$ n p@$0( 0 j 0ȌQ$0( H  p h@9 -L(MLH0(! P pDP[ 0S_ T+$0`VH$ RD H0 T0C\0S/SA\0/S a0` $0 T0,0 Rl4   G`PH4D 0S- 04000T0`/V dq1  P04 W3T ``T00(K0TST+$0T`t1S   p3;<408`0@P(0Sz T0 PX0`P|H0X 0# RR ,0S0,0$0ST㼏L`0KP PP 0PK@4` H0 D@ 8 `T)4 02 I00-$ Rl$ `?`04 j2H0 ;H0T$0PS0hh -LP`d @pᨎ 0DPL0H`p00 0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R00 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R0 R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S/0S/P/0S/P/0S / P 0S/0S/P/0S/P/0S /P/Q00S/Q00S/0-l@0l S0/ UTR p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P0 /L0P/P 0S 0R/P/h -LM 0 `0p00Ġ R 00@4l 04 0Q$0 $PK @$00$0 08P#8@$00Kncch@-0@ d0h@0@ 0$@,00@80<@D0H@\0`@0l0X 0    ( 4 @ L P T /(0S 4 R808080 Q(/0S40 40808/000/0  R0S,PP000 D000 ,0 0,0 ,0 0 0 0/lhDh 0 0C 0/S/0S/,DP000 8000 ,0 0,0 ,0 0/Dhlh -L@p`\(0S 4P7/PU (0S \ -L M0   K0 P K謫&-2L?0\ \ T 0S0S\hT0S /0  0 R  R T 0\ 0R0S R/0@- P@P -0A0@n@P/ - pLt ㊋(0S0 (\`0h d0dt<0@@lP`|0LP T0X@DPH`Z ⁉AZ |Z Nxeo is -pL@T P` 0 `@S ފPQ 00 R 0 QR08.c4.c p-0L@`T  P @T ᳊P p@0@Q @`0(0Sp3/p8.c4.c 0- @RL R000 00 @P D0S& 0S0 00@P00DP0S S t0d 0?T0 R <0< CL0Q0P0P0P0!CeL/cVUUU -LP  p R R000   D0S 00hjL0\0P0P0P0Ք!Ce9 0-0LSP@0@00CST00 D0D @0S0@ 00@P@0嶔9 -@Lr  tt0P \ 0,0 ,0 0@h0S,0 ,0,0000@0Dhlh -L@p`PHH\ 0 [P  -L`p/D@PT! 00  R 00@00$ ST0WS  D@PTW 08 D0S <<h51<9$9 -LPp` 0@!D0S  0 @PdH0@SD0S `@ R% V@ p0S'PD @VP p0S00&00 X,00;00@@U@ RDP) V P @PP p0S00800` 0<[@P  '  @VR 夓H9T9l9 P-LH00CsH0  S00Hh/Z勓9 p-`LV@P 00   R000   pH00H0!Ce@-Q @P-\ $0 R 0@SgD/c -1l!RL PpU. `PU 0 00S00` @)*W`pGZ`V Z 'P0@X PU`(B ?=j.cg'5 99 p-LP`\@0^0$C I pp\ 0P @0  0S p@0@  0S p$3 0S p 0-L$@ P0R 0S  0Q ;kP$0 0 0-@LTP0$ h d+000茡& - L@0 _j1 S+ -LM@X `RP RL`0SIRGSE01 t+딀PTX 寶pPX 0S ` R,p  X`0,0 \៶pP  1+(K` 0S 40pP0Sp R 0,p{lP00U0Sp0p00p$0 p40pP$0 P<$0Z 09@8.c -0 MLP`@PP 0ptPp@l^p 00@aSH HH0 @0@@RKhb;Phth9h9lhDhh - LF9 -0 P0@L`p  L RP0P0P0    0EL X000 RL L0P0 @PiH/cX/cXhc 0-@L0 S0(0PPLQP0P0P 000PV0 -pPWL(` `0P$@@0$0 0 @$0@0$0L/c p-LM0K@ `P000  0P` Q/0 ?0S 0 00^00p80 Q$0  \/ccccH/c - Lh0@P H T0R FD D0 ?R4 0 00edThgL/cP/cT/c -PP1l!L `@4!40 ,P1p P 0 @ TA VP @ TA0 R B ʐ R S0( pS( 0PP 0 Ic, =jThx%cX/cH/ccP/c9gL/c 0-0@0P 0L?I0 000XhH/cc-0<2 -LMpP` - P  0 S0S 00T(0 $@ 00 0@(KP 卜 K0S -L M`@Pp P " 0 S%0S" 00R$0 , (  00 0 ,K$0K pRK0S -LMpP`  P  0 S0S 00T(0 $@ 00 0@(KP l K0S -L M`@Pp P " 0 S%0S" 00R$0 , (  00 0 ,K$0K p1K0S -L@HP 0S  0 R 0 0 0  p-c0LM0|PK0`@ `0@h0 d@ PP`@0S PKpT0 0"$ R*32C 0$QK(!0PP(1 Q `(PP0S\0  ncZc p-LpMP|@Kc`@ 0P`rP `0(@y`Kp -L0MP@Up`( Kg`P( 0 ` 0S 0S ` 00CS 0 $K(40K 4 @` T0 P <` 0P 8p DP (TK0L0 H@  ,0K{L0K( `0@V( D0( 0c0 -LxM@ (fPP  0S; 0S7  0S`0 S S 0 0LS 0 (K K05P | K  0Y S 0 80 0 @80<@  0 -LMPK` p0@`0l0 h@ @P d@T `<K`P @K@K 00 0 ˠˠ `dK< K @Pd0 0 c -LMPK`!0`@0t0 p@ ]POlp1QPK!  0@`00 @ F@P(P`U 0SC 0S@ W@WC T* KV9 U DKhh0.,sDKhh#!|P 4dt $KU `PKhl0D K  @0S@@,,h -LM @p -LMc0f p-LM KP`P p0` @ ,0 0`r  00CS 0kp -LxM@( KPP#(`0W00# 0 0P  0SP PP  =( 00CS 0 $K (3@K|` xp (0  0 P -LxMPp%88S@ 0D [ K[i@P K 0 ` (0S $0@   00CS 0 @KDʠ,ʠ(!0 @ -`#8LM8Sp'0D kk PK@  0Ppi0@l0 h@ @P KdP de(0$ @ v@@Kʠ,ʠ(!0 Q @@ -LM @ -LM c -LtMP`p -(0S $0@w %P㔀K K(!0 @P 00CS (!0@p @ K@ -LpM`@pPK@  0P40@l0 h@ ~P K d@ -LM @ -LM c -LMPK0cp@ Pp0@t0 p@ J@P $Kl 0S@ (!0} @P @P`K9@0(!0@ P @@ p-L`P@PP0S@ p@(!0N @P p-c0LpM0P|@K0D P`L0@h0 d@ @P`00Kp p-LM@ K`Pp0 P  00CS 0  p} p -LpM@Pp$`P K@K0cD PP`P 0Sd0 0 dd0@ 0 0 -LM⤠K@ p 0r80  P0s r 0R-@$K P0s080 0`KO0s0s r r l0Rl0K P (0$ @ x0K 0(! @ɚ; p-LM` KPHPp0 @w  00CS 0  p p p-LM0@SP 0`K @P Kp00`K(0 0 p-L0M0PS` 0K &P(3#1C!B0 1!@0 4 00K$KH0 D@ < 8 H KKp0@0 40 -LpM`@pPK@  0P40@l0 h@ P K d@ p-LM0@SP 0`K ҩP 0Kp00`K(0 0 p-L4M0PS`" HK 㶩P@43#1C!B0 1!(0  H0K<K00 ,@ $ c00KKp0(0 0 -LxM0( KPpi@P $K(0 `  (0$ @  (  00CS 0( N-@P  00 ! "Px0 R K (!0w @P0KS@ %(! 0@ 吀 p w @꜠K D/c -LM@cPK`P0` pR@1t0 p@ @P $KlP N (0$ @ _ ,@P  00 ! "Px0 R K (!0 @P0KS@ (! 0@ p  @K D/c -LM`@pPPK@  0P@1p0 l@ PP  Kh@  (0$ P  ,PP  00 ! ;"P|0 R K(!0 PP0[S i(!0P p PKP D/c -LM@ @K -LM @c K -LMPK p 0p@}00 @ PP`0SP  K(0K(!@H0 0@0 <@ 0HKD 4P $0 0P 80 ( ,p h 80 0cP0 -LMP @0  @K -LM c @K -LpM`@PK0cpD @&@0l0 h@ @P d @d;K -LMppPKD  0@0x0 t@ pP (KK  pc ppW!xPK`0@0 : Sp>0I00 p p p C!P0 l 0 p -LM c -LM @ -LM c -LppM0@0. ,( `PK0D @0x0 t@ 1PPWp V (!(K R !(0 `0 P@L@@@ (!0NPP y P 0R !(0 `0 -LM @ -LM c p-LpM`0@@ Kp|PK P@%@0h0 d@ @P `P 0 \@8K2 \P 310S\@\P@R \8 K@^\`8 K@ 0c0  0c -LM@pw`+0R@P y$KPK0 @0t0 p@ a@Pl0S hDKhl0P l_@\@KY0hlK ˠˠ0D K `@h0  c -LpMp@@5 PK@ 0@y0p0 l@ @P$h`0Q  @pd0p0 l@ @P h0S d@Kvdh0P vh@ Kd@ K@ -LM@ @K -LM@c0 K -LMZ X@p`#z) PK 0`@2x0 t@ PPp@TP lHK lP !T (KePP0 R P\K 20:#:  D0娠 ;;0  X  X P-P X  X01 0lpKH K|P01 01 -LM0:#: :  -LM :#::cy -LM @o -LM cf -L M`PP K<@K QP0PF 04K K P (@(p 0P$048(0/㭥 -LMp`@P KP Kd(PD(@0 P$048(0 p -LEM0, 0! @p '`P , (! N,K0 K`P (](K0 0P 0  0002 0D0 ,0`K @ ル0᪫p>0O  0 @ 8  0 [$!   e`P Vx v` 0A,0 $1 R`P, 8`吀 ,0 ,00,  6$!R ,0  `a (0$ `\0SX `PUNK 0! 0 ,0 0`PF?0 0, $00$0,  00CS 0m,1i0 @@0 <@ H0 D@ 03KK @0@cK, H0K@w@P 0,}`G8 R0 0+`P},o0007`s , $00$0 /c -LMP @0  @K -LM c @K -LMppP  0 S0PS  G d@(!0>PT@ T P(K0 `Vb(P T@TP `R  -LM1, ΄ 0 P夣Up1$048(0, `P+PT @PW X*Y(`, 0P wPTW X00`(K0`dk:h -0L p@TT@V 0 `NP$P@0$00(!@$0@0$0h -LM0`S T K0 P00PUp p@0S 0S PU@0S W @@7T  i 0p 0 c 0p0 ] 0p0| gh9 -$0@@0$0Lp`?P 00$0(!0PP3 0PP  $00#X00S% R0 00  0 P 0T0 00C0PU &.q |h9 -LpM@KcpD 0Pp@PhP(1(` R `@P$0   @ K0  `P@ 0f@ -LM@p`6PP (K蒠K0 Z ;PPKcD 0 p QPP܀ 0<P[K(!0PP.(1`!R PP$P  .( `$0`(!0PP0S Px0T@x&.(x p $ t! -P{P(1x Q PPP  t``xPPx!8$$x$x$"2 0x!$x 0 xp 0x$0x`xx!0(  x 0PP {xP x!0008K ;PPM10Sp1 Tp \p O p18KPpPTP|  P P &*x px1  0x4$ 8$ px(1$ |1t1 D^wx%ch8.c -LM0 0S- K3/ -L M0   <0S- K3/ K -LM   0 $0S- K3/ K -LM   0 @0S- K3/ K -LM   0 D0S- K3/ K -LM   0 0S- K3/ K -LM   0 0S- K3/ K -LM   0 ,0S- K3/ K -LM   0 x0S- K3/ K -LM   0 T0S- K3/ K -LM   0 0S- K3/ K -LM 0  0$  0  40S- $K3/ K -LM   0 L0S- K3/ K -LM0  0S- K3/ K -LM0  l0S- K3/ K -LM   0 (0S- K3/ K -L M0   d0S- K3/ K -L M0   80S- K3/ K -LM 0  0$  0  h0S- $K3/ K -LM   0 p0S- K3/ K -L M0   t0S- K3/ K -LM0 0   0 0S- K3/ K -LM   0 X0S- K3/ K -L M0   \0S- K3/ K -LM0  0S- K3/ K -LM0  00S- K3/ K -LM0  `0S- K3/ K -L M0   0S- K3/ K -LM0  0S- K3/ K -LM    0 0$ 0  0S- $K3/ K -LM0 P0S- K3/ -L M0AS''D'D'D'D'D'p'D'p'D'D'D'D'D'p'0   H0S- K3/00 K<0;0 -LM0 0   0 0S- K3/ K -LM  00S- K3/ -LM00 0 |0S- K3/00x 9000/ -@ ML̠ 0 @PK Y p-L@P`D ?    0(Pp pP9 0 % -L|M P@`\(  (0 pP00V00S 04! @PT X  T Q L00S pp$K(!KpP x00b0at f@ -LtM0(!KP|PC l -m0K0 @  00CS6 ' ' ' ' ' ' '@0K4;DL0P@|0KpPK`D0H@dKX0K P$`80<@,0 0Dh\P@tPH`Lp 0(4@@TPX`\p (K   - pP LR1 ``(0S $0 0 @ 0 @2 0 V `00c@  H  0S` ` -L M p 40 R0 0,0 !P`Q VP , 0 @ RP 40  P000c@ ,(KUP -L(M`0 p0K@0 ,0 P L H0 D@ < P8p 4 @' W0 PKZ@ Y@00 (K0 PKZ@Y@00@0 S T R@ e -@0L0C0P`p, U0 @e -LM$0` p @PK 80K0@ ,P 8@ 4P K 0 K -@0L0Q00\0S  01 S ppW P`V  /RU0 ` b 0a0 -(0L$   R0 02&0 1 P -LtMLp`@(a 20 S] ,< D00D H0UPP10S-PK S>PH K ` 0SP< PP8 0|PP1  0Sb  0NPP%0 H000(K  0H0@0H0DPP0S D 0P#  0 0l PPSPPK 00 000 @ 0 D PPk  0%PPd@;0  0d0 @KP 0@|@ xP (PP -LM`lq, G@P t '000(KP$ 0 St @P00$00\  00 0@P 00, @ =j -SLM 1 P  0K(!`P~ <(p0 \2@`0 0h t K\ t@ l0 d@ X@ G`Pp!PRP u 0 S  ` @K02p`(!@ P 4`KTK,0KL H T` , 4p 0 D < 8 LK `RP  1 P!D0 c\)ڰPH0S6  `\ ڰP<0S0S 0@b1S"`#(:00  (K ,0S `f000_@@0S0`h@`d%: -LM `PQ4 0 , p0o 44 @P#X04 00 R@080 r 0Sl0 )4 02 UT (0 4 40SO 4 @P 4 ,4 W000Q 4P (K8(!0@P*4 =80 04K,K 0 K0p@ T0Q0A/ 00  A0,0CUS4 0,@  PUl0P,,@ 0 K0`@,@0Q 0A/ 00  A, h -LM0 Sz`@S"`p?à@  @( K0D0"D0P0`;`P   (K, ` 妘` - 0LS0ET0( 40àLZc -0LT , 40#"B ,0S-3/Zc 0-@L0DPS <00S 3/%40"!B 0hLPc00CS#''',',','','',',',',',',',',',',','4' 00/ 00/ $00// 00/ 0-@LT 0 .$ àlL*PPT  ,88 #Č,$ T0 505d0Zc -L -LM`pT 0#((0"4S@(PP U$ !R0 U01 T(K "88#"$ 40@P T 101@ T ( 0T #40CBD * 0| @l`T (t( 090 d00(  (0T `0d;0Zc -LrX9 0-LM0T  PQ%4@ Q Xr HL 0à L0l9LPcZc -L M @TP P@K - LT0$ "88" #$qx9 0  /T 0 p-P@0L  ` @ T04 T00@ p 0  /T 0 -LM@P T0R p  R -r0 O  00` ? V- (KP? *40bl f (0P0  0f 0`P 0 5  06/`(KoP0  *40"!B ` YW 041S 0 R04!0 0 06/ `99ZcLPc -PL0pS( jD@`T 00  R 00@00 HLD@`T0S  0vq99 -LMP`( T0R  $01 (4Rp R@% 1 W#*1 R 0s 0 2!1C0QX 9@PBAD 0*T @D1 W:@0s 0 1P3!2C0$Q1 P{p , KP ,0S$VP3ᘐBC $0S000(0 @ * 0 @4q@@P ncgLPcncZc -LDMX @PP 0S S p 0S@:X@00 T2  $ R21C"0 @T P@ K04/PN 0C؀"(40 0ȁV000W 0P0d@`?L;c00尀,0尀h0T,\0S0 S0;Z1\hlhQhhnmo8o8dhk_k0@-P\0  U0 @  R 0U 0  Q0a R.00  \@ R (0U 0 P 000q8o8E-@Mp 00 Q.\R00S .0Wࠃࠓ0ЍQR J \.\ 0 S.SQZ0.SR.0Wࠃࠓ00P^ J0 S .SU \ ^ZX \0d `h`cV 0 S  ^Q 0 0LV \00SQH\ᠡ'P0@ S  ^R 00A\  Q00SRQ 0S0C0^ Wࠃ~\_00W @0'!000c00 Q 0l T0#02SpRs  B0 S 00l bS0a  ~0 R0M 0 Q0F0 s R .R p80@-@0 S0C R .RN21CP 0 0 R 0e0@ 0  @@  ^@%J 0p 0 ^ BJ0r0 ^J0 BR0000@000  E- @@  0S ~? 21C0 CPbUP U`p@PEupG8 0`P0@Sw@pPUpG&J 0`Pᐠ0@SwPU@J 0P0SU@ J 0P0S 0S o8p@-@?0|03\0SP`@ 2 1C 0 0q  ? >1C0 0C 0S0 00n 0C0p 0S p/SN 0S~0S0 00n0C000Bp/SN V:0S~0S0 00b0C0/S 0S0S0  /S 0S 00L 03 0A0q/Q P@ R .RQ4 0?Ac/Q/ 0?Ac/ON -`PL@`@0`!0SXa, <P`DP@1 0!010QP !1>7 Q  0PP 00C0 ` 0>+%0à~pLR2 "`l B3!1C0 T  `00@0djthpho8nmo8QQ;H9 R/0S  0/ 0-PLd@ P 10 0= d0 -LM@p( $0P PK0`K3   , 00     K0  (0S K$ K PP@$ ^$H ^K $0 $0 L $0 $ 4$ #40$ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40X$ X0$ #40K$0\   K0$ \00#400K0$ \00#800K0$ _000, $x0sX00#800, $x0s[W hPm z N PL0 s0VT K0 0K0e U R -LM@0 pKP,` x0s  heiP(K \0WlW;X0 00 , XpdX01Y0\p$00W 0, r 00K6PPX0 G2#,h l0Q= x0000s7 /PdX0A1A ,0KPPdX0A1u\0080 Y `X ,0H `0Cd04K 县PP 4 IPPX0` 70bd040dH80cl] 4圼4cx9 -LMd@@0S` (0S`Q@0S b( $00  &0`@0 -LM0P@, x0s` K0p`\ R#*d0X  B2!0C03r T0Q` 0V`P0$0\P0i0\ 0p'i9 0-Lp c @SPQ0t `P2t0s H8VZ0<0Px0s=b,l 40u@Ph0, Pg p@ X,0K@P4 Oh W0@t0x@4 , 4@ B9h,9h -LMP p 02@$p  0 !P  0P:0RT0T$pH0 \1$^E   !T00T01 01$pP0S6:0-lP`P00W0S W )( K,0K"($K ,0勷PP$px~H 04 0 0, $pP K$ -LM,p`P4K(K 0<@P$,K(04KRP,(0H R:S 0S Q0SͲ$KɲPƲ, -LMQ@`PdX 032`DnP6"\050@0 0 PpPX 0\ H `X H0N a 0PpP 凲00 -LM@,0   -LM0,`<0  <0BPD p,K8 K0PP40K,08KöPP.0, H0P*0@SH0 @0S0S 0 TP 0, H0 @0S,p((KUP0 <\PP0<00<0 -LM,p8K,K 0V@P80K,08KlP30P,H0P *@,0PH0 @0S\ 0` \ >TP d 8TP 0ձѱpͱ(KT0ı@9L9 -LM(0 0C,Pp(0 @4K,KX @D4 0`P1(K,04K`P-(\0H0 R 0S  @000 A @D\0 0S (&`P 0\ 00T00S$Ks(p -L M, ( K0 K0 p3_(0S $KXX0\p \H ,`x0sA ,K`X H `0Ld0 寵pPA,H0 @ 3  SP,0x 4qP0 40XX0S) U% q@0S (0P, (0K,p pP(K0 X@0\p,p\ W,,pX9L9 -L(M P\L ^p,:dX0  a<à  0, `PX0\ , #\ X4K>< K,0K`P ,0H S\00K H 40<K)`P00 \ H @@ SH SK0 0 L0 0$ 4#40% 5#40% 5#40% 5#40% 5#40X  X0#40K \K0\00#400K0\00#800K0_000,0x rX00#800,0x r[000$0SK`P0K40<K喴`P00\ H @\ 0n(K00寱`PL R K0 X, x0s P0H0  H L0,`@0P,` H -LdM 8 t @0|0 P x d ` 00 ,x \ `K0p p(K|@ 0Pp |x *Pp | @0l@ ' KK0P Pb P0p0 X T  \X0 0R   S RX q P `m 0Y 0 S0C R .RY0h0 40 d0 p0K`d@ K,0KP?\8K00@K޳@P10P88PH 0@ s 3S00S9 X0S`hp R PP pOdd 7 X T AVX `hp V0fh2h Q 0\0"'p [ x | û0p0 SX`X 0\`S  P} T0S08\ 0 0  80KK ^QP` p`0$0\0x 4r` ,0SPZ V,` PR8 v 3\x0s00 @`Rt P 00R00SP  N u | 0Pp `X0S  Z Rp \ ,40KPp l 40R x0 0;0|tX T `\ pX 0B$00.S  R R0.Sp`R ,` P `X0S  Z R= |l| x 0  x | P0  u | 0VPp `X0S  Z Ro |H| x u0 40@hQ`N0p0 i88p@ eP p a\ ,40KPkl0S P t|06040x P   `(0S | 0 Pp :X` 0A$0h0 0l0\;0p ,|ti0 6p 0#t|`0\60 ,40K@P lQ P  %40 x0 p\ ,40KPp l0xS40 |t9060|t TP0p@ 6p@ 0t |(P060 40p  /d 00  00/ 0-L\P @rP004  0 0 -LM0K@\[P00 0  -LM"0K@\JP0   -LM\B`0$0 ,` (  h0PSp 0SX, KU H s 0P$ $K[X|' 9 0-0LSP@d0 0< 0S A P  0P0D0S 0S -L\ d00dpLP` P`T0@0@TP`P `2,p0@$0(@4p8 -L  pP`P\Rx T0`@0Q  < <; 8$0\b:$0 -L4MT0Pp M@P (KPt7 U@d `(!0``@ T$0040  0o@P(K@ H H :@P% T R00,P } 4 0R ^V P < ; 0\2,0; KH@ 0 4 !0 4 !0 4 "0 4 "0 4080 0$02 0$`08  24 \ 8#8R$402@SQP  0 400 0,0 0 @400 0002SL0 $PP80S 0 40S0 x0 0 40,0080 0$ 00020Yt 8 0Bp \n:0L k0Qh 8@Te 40R<0 @ _<<,0! <@x D 0,8<@@0r000 L 2B!?04 H @D000H0`T 含80D 4t0LP QT 2R 0D 0 D x 2tQ0 08l0l0q0P S0CP0l0 4p0O0@4 C`\ d0Nd @0RX O@@0 40,0P 0 R,S0,0 |QHP0 0B =P< 0jP P@P$00104P0010h0 0\b儠 T0h"0# !B$$ 40,00@0H@&0%< 40| l0  x040+H#13 l@Pt,0H@ SMP 0|0,00 +0 ,0,0 yX BMPD `P (KKX Z 03P`P KZ 07p cK@ 0坿@`P0S`' D Pw010 0$00(!$00  $0`P ! $0T x 0 #40S`P $0 <LMb0(!<`V$0F 0S`V\R0 0  00A?x0s: ,K@P)  `bU/K`\ KZ qLj@ (! 0``Vv E 0"`,0@dP,0 0@00A_Z>LP\Z MZ6LNKZ MZ.L Z M ox )Lnc //E//0 d B,0R+ '|'|'4'|'|' 'T'|'|'|'|'|'|'|'|'|'|'|'|'h' 00/0   / 00/ 00//5w-`| @!0P#@`$dd!!X \r 0' @(?0# O $ Y `@&0#@/8^nCCX좙N 1s s s /40@0Dl00l /0@0 0@02c1c1cDl R0l0/ 0S00/0-D0@Qd0 \0<@P@TP0 @$P @0/00 000! 001@Q@- 0@ 0$@/!00100000@Q 0 S /1 91/ 0-L M Pd\ @0 00鞹K0 p-0Ld@`X 0DVPX4%(P%(P 0 0"$Vp99:9 -LMd\@80 P(,p  00P 0d@Y! 0 8 P4 Y`` 0 0 KP ` X080b3@_00@PS P0F04(K,0S`Y -LM0 d0Q 0 00S  -LMPp 0d0CS<ltP `q" T ` 0D0 |p0S 0t o`P 0@t0x@8HJt0<0rk@zt0sx0sV90d4V -0Ld4j0 d4 -L@- -L@ - -0 LR@d`dPp pl 0l V q -LMPdPdpWapP 0@ BpT l ul mpPᒲ 0 pᆲ p-L M0d@SPP Kp$`K0 00 , 0 00 000VT :K0 0K0L0PN 100R+0 -0@,L6Ml0 Vh -LM Pd@pX0S  \0R`#:M>$K謠K xmIl K`P 0 !0 0,4Ka0K00  T` P` H0 00 ,0 "0.00 ( K0`P0  l0 ( 0\K^ K`0K0DL0VKX Ka0[ 0a0K0 ZK0h -LM0d`X ,pR  \0R#:L(K@0K 0@PKx<@KH00 p 0 00 0  000 `X 00H `0Cd0 PPPd@HHH@ H0 H 00#40&[ 6[#40&[ 6[#40h [ [6[#40%[ 5[#40&[ 6[#40x Xr= !4 0 0 &[ 6[#40&[ 6[#40h [ [6[#40%[ 5[#40&[ 6[#40x r ᧧P t KP) 0 g00#80- [ X0#80[  @0S 000y dKf Kh0Kr0^K` Ki0[ 0i0Ke@ P0K, K 0X iK\ @ P P0  l0 , 0'0 bK0Kh1c -L`M@ PP', 0 `((0l!(^x \p ,0U ,P D0B (KP (0^\ x P0dd t K0\ P  0S t0Q 0 0 t0@t @0\ 0P l 7d0,l0 Pdlp 0` l$0 6x0d dXX0P PQ  | X  Zp0S ,UltPf0 J ,K P],dPdl Pp p  | X l p R K0jP\\pl2PW,l0 , p d? KnPE00 0 0 XQU  0KB0PR dt T d\h 0d0 T P\Qp0l 0x &zt 0@000q-nx0 .R?x  pQ ,Y00 X0 |0 xPB \0S ឯxP R?0S7:t @@6 JKF?K Fl0 $0` 0 tl ipP JK F0S0th(0d 0 (0htpP 0S x0x0S\\X`0t3 l0~@P Q x0pgt `0S\0 00TQS x| RN T0X@T9 `X H `0Dd04K opP'4 $4H0@x0lsX 40  0x0s $,$8  04健pP 0!@0S 04ӣ0 kRiRgReR=j h99D9 9 0-P@QLdQ0hM -LM@p0d`SP,0s0s0s (K0s(0sX0s\0s`0sP0sTq (0$  0R  PT!88S(-K0 0K00 00 y (0$ y0  ,0 s 0,0 0S P0 S 0, S p 0S S  0Pl0 (0$  0R P l0  0P0S 0  40s 0,00R0@0s 0800VT 0K0 0 K0 0s (0$ X 0S PQ0S 0 K0K000K0K0K0 0K0 0l (KomK0 0K0cYw 0, S~ 0Prm(0$ ~ quJPT@0sLf40sy@0sv -L M0,pKdP,@`0 00, 0 0{ 0000K XS Pi I?0K0P20K0  )<@00 !!   ,0 p0 0 ,08@  ,0 Xp \0 $_,0 H,0DTK0P 8T0, d0(0,\ \0 00@\0`@ 00 K\0S0S`X H a0C0"@(2"(@1x0s@00!~ L0PN 0w ,0 L D0T 0VK0, 0K00 0_0R0 0-LMPd0K ,d0I <@00 !!  0 @@dK0 -L@ML X d 0T S,0P0  P`V` T@K00H0 T\0 0S `(KRPX05s cr SVqQV8p 4 dL0,  d `0 \@H\@ dQL@ T D \ < LP@0X 0@@b b3a R`Q<RZ2/ 00K Xץ`0PVd <0Kd0c<@D \S0! lS0!@  lHSP1P!L  `0HV%L@0SU P`Y 00K X尥`,KT8 K0}`PP00K8K,0咥`H\yX(0$  T000pn -L]M 0t d0x1 K ,  UKFlCt1tA l! h1 @`VA a { [?K0@stq`1x2X 8#8R1 hAT@ 0\! X1 @| t1\ xql|!\0ba[_K`W?KPU`X@X\0d A ՞50pa `2 PV1Q 0d! `1 0 W p!p1 x< K00K,@K@P 4K,0<KP 4, <0X! cQ!H! 0P>* PR `[?Kp`p Q { la hq d `! p! H!A0 P0S 0@ `pR Rl h d ` la hq p H!A0 P0S Kta\u x!|alA\0fa[_K`W/K PU`XX\0d 50pa `2 PV1Q W p!z`!rt1W_K`PX`t1[K Aq 0t0g0x\ PQڌ1 00(Kx0s | \ X &0x p40 40Ȍ< \ p@0T P 0B1KpPR OK {AKA[ 0($0(@K0La Hq t(K0Sl:UKt!E P x0 4d! `1 0la hq p1 G01 la hq A04 00,0S00SX `H a0C"0n2O@  0@ T1 PA B!KppPA[(0K 01Bp!UKp 0@44[Kd ` @A i r[_K`WKt1PU`GPW0 0V@0RY|4q- tAWKY_K`PU`YKl h! )4IW_K`tAPX` V lqRU'^0OK,A1K_C [oKA1[  L H! 0!0(pK0t(K\%:UKt! P (PUSKl h! 7x0s 0@T1 PA 0UB1K U0OK,A1K+C@0@T1 PA ?P[K`P` ! t1?P[K`P`la?V taWK[_K`PU`4۞|a 0O[_K`PU`[_K`WKPU`|:d%: -LLMh hX h@\ d 0T ,PSPP P Sr JM\T\0 0TcP` Tb Q 0@TZW X \ ,0KPNT \ L Q0@MJ PppXdP RPPd`0@X0@031@ a< QT>QL @P0C T0PP@ E P\P@> \< T& L< 0Td0l@Q  ,0@00(KSP TfP@ T0\0L0 @ P L@d0X0C03<P@P 0C`P @PH@ DP \PP P8 P0  !0 0 !=(<P 0`P Y4K l0 @<E<08 S 8 P8(K4K u080 $00  00- L@0PS Il Rp0p0p0 A00  0- L@0PS`  0R` p{ 0s: $0S71 $ PQE :0S QH p P!$00S":`V. 0  0`   `0 @ 0  0$00 0 pP` #P0SP `0 0 0 0 g9 8 8-#TpL` @P`0hP 0H0 t D0 0,0Sl0 l0p0@p2c'h - QLM`p Q -iQ Q pQ0 )*00@Tr i0TP,0 @P  pP q r17p Q00Q0000 0T 0YY V  7 0 0i 0   w`vp ,K7, <4("4!<0 -0 LBM0 PX@PP `62P PPK,0P~K  K0ZPP l 0Sq(Pt0(07 0D@ R 1[S01K[ @ 0HP000S00 ҇/0A S@-2*Qf 1@ 0S'x'x''' ''`'`'0@S 2S K S 0S0S Q0A0@S. )ڀS S) `S 0S0 S 0S @S00Q00Q`S pS SS SS S0S:00:PSS 10 S R2c -LDM@phK@6TP@D`y @0S񟗻''''x'h'`'X'''''P''''''''D','''''''$''''''''''''''''''''''''''''''''d'P''' ''''''''''''''''''''''''''''''''|'d'''X''''''''P''''''''D''''''''<''''4','''$''''''''''''''''''''''''''''''''''''''''''''''( K(0PS> P$K( K(0S0a/P-Pe+ `) P'5V%05S"V 0S0$ K10D`0$ K10DPP0P ( K(0PS P 01@P001@0P( K(0PS PU:01V 0P0U:01%PU01x0U010U 01Pf0S 010PcP`P^01@0P0$ K10D`0$ K10DP`PPE -LM 0 0 Ki K P- P/`㬾t9@Ua \9U KV0CU[0CU:*00CU (9U. 9UP``;` ` 1'`8U~@qḿ`8U R 0CU 0CU 0Ud`PT1S:  3/0`0 b08U % 0CUa 0CU 0UF`[7U 0CU:l0`` 0C7U /70CU 60U+7U K7U 0U 71`` 0)`7U ^T7U 0U4`P-P` 7`&(`P! Q`P T` `P0` p00`` 0d0`0` 1`PPPi @Tt0 R00  ɽ6@e  m  ,q  TP0`t0p0`` 0t0`` 0`PPK@ ,0K]`P  00 `P d0   <#d0 (0B8d0 "00 `P6  $q#!^ """!1# s8s8   p-@LT`P6 T T/p .$ *$p0S 0S0S @T  $ $p3000 00   00$p@T  l#d #p@0^  0@000X B00#p2c3c2c2c -L M@῵*PK0pK `P6hBT,@T)  #P #P 00CS 0 R07004`  l20Cl2 ~#Pp2 0Cp2Ŷ ¶`$K ἶ -L M@pt*K0K` BPP*0[᥶P$K៶00[ hBT@T  C#P  =#P 00 0僶7 @P  O#  K#0 0h" R h"00/hB l2 0l2#Pp20p2]4PY7P -\ \:6S0d0\-P0P0l040\0\ )r2i 1i i i -L@H 2h”\ ^0700 h”\0( -L@R0`2< D0Cb2a" @00/00 c2 edc p-`2L@"P0 `iH14 hp j`lP0SPX&0i "0h20L ph3((5(0( -PpL`Y0 6 & f"P2  `"P11<<110 0@0@1  % 04"48#HP1TD D1T <1TD 41T00S 0S [ T%& ""P 6_0S 0R0SY ^PP  $"@0T6 a,czY2c5݆?cLc -L M`PAAPp 2@ [(K&R=3(X4(4(X4(X4(X4(X4(X4(X4(X4(X4(X4(X4(X4(X4(X4(X4(X4(X4(X4(X4(X4(X4(X4(l4(X4(X4(X4(X4(X4(X4(3(@.K  !뼀 6^PP7@ @ ἀ !  !C@8-/@0.K @P␀ #T#@D.K 0a@P1  6  C0S , 0]P  jh9ʚ; 00S S/`R/\0S9\0/p0 Q-L0CQ:D0Q %0CQ6@06=0l02i i -L@ S d H00S h" Zd0 3A[-9 -40\ @RL&. h p- L`P&I@P p 080,9 l00&40 0T!H1 0Uh j0i L 0%p)\ 0 9H5(d5(5( h -$LP h,3c90- @P@ P 00/Mp- 0\  P`P` \ 00S@TP \pЍ/@-xp`0 l0@U  0 @ RS0V 3c -LPp $0`&,RP0 Z w x\00000  KZ S Z  -PQLMZ` V 2R. 2R@ 00St0S0@0(0,@0@0@ 0$@  0S 0S0\ ` @&0`p00 P<PC  0S 0S6 0 p p@P  p 0  Z p1 p!PW00` ! 0PW`P@ !0`0P @@! 4P@7i 8i8 -LP`@  pP P `p0000  0+9 -LM00P4 0 P $KP`04K`@*4PK`< P`0@,0 (@ ,K0 P 0 ,K0,K0 PPz+9@9 -LMpR`@P0PU@-0S  0 00Sp@- 0@PcUe\5*0   0`Q  ^ T 0SQ 0S p?R00S eQ 0SP 0S pr3p 0\à@-0@    @ @0 -P` Lp 0  0S0@Q :* 0 RQ /  \0R 000Q ^f 2 @ 0  @PP0S:  0   @ 0PP00R  0S 0 S /000S/ / -pL0S`0S 0@T  0 0S@0SP U 0PX 8/PU 0 p-L M`P^ 0S:Kp@    0P `0` PP*00P8 40R#*ccccT90h\9 -\ LAp5d0 `<0@@ 0 0 @P0 `H cc 0-@PL@T0\ P00,h 0-0@SLP0P \ 0P000)9 p-@ LTRP 0` 0S 0SX 0CS 0 p0R dw)pTr) Q R 0S0A 0 pb)p 00CS 008C8S08C8J\0 S  P RP 0S T T  0SP/) 0 p4')p0$0 p0999T990h -L@ T@P0S R0U0U R0 0T p Q 0 S R 0U0S 0 S@R 0S 00 0 \ y`P 00 00 0@000``p (`0h9 -LMⰒ@0`T@!PRPT%Uㄢ||2 E eQk*0PSh 0RS BQ:`aU"0T`1 @q TL!``0@ 0  @@0S  EP@TXppW0 P @ 0 P,1, K 0x,0@S2\P P Q0h 100 0  d} 0 00d0 R 0h1000@(  0LSccc@;c,h8t89 -LM0 P`@ 0  @@0S  ePVP  %P P 0S PU:P Pp^# UL 000Sp` 0 @ 0V@@0 @@ 00 0  @ T0@S@@Q 0S!0S   0S`V  0Vpp0 pp0pST@ Q T00S 0S ` 00CS 0000R 0  @N'0990h -L M` @ 0  @@0SPU00  Q *0 R 0R  Q 0@P(K0"0S  0S Bf100U40 PPU  0U 04 RPU10,0 @PUl04QlPUe 0 pP 0\ P  S 0 0 0R !\0, 0S0!Xp1Z0 0  "0 0p 0 0# ^P 0 R !P0  0R01p W|0  "0  0 0#\g TPcPac Q0-L@P+P0 0000 0P  @P00T00S P0P00T -PLUPp+  R/ U@`#0`S(  @R" R 0Z P  0R:PW  `  w 3 -`LV08CxW0 08C8J\0 S  P RP@T#@T 0W0P Y( 0.0PU% P  0R:Pڌ P]@P 0 0 0000P@ 0 R 00 0@ o%% 0h99 -LMQPp0`%( K0( @RV 0 0`  `( RR(a0 00@0 `P@ 0 P @ 0-@PPLa R000  0h20 / p-@PTL`7pP0P ldPpP 04 a!0S00@@pD;cH;ch0 /h/ - QLp@`0P0 S 0S-`%U`" T1W(X(4X(4X(4X(4X(0X0\\0S\<0(0<0d <0 -0@S0C00``PLp PP70 㸶0P d0i0S0C000S* 0-` \0LRP 0d0 40 Rt 0P<044@(0004@0 1 -Lp`P@T 0 R ~P@@P@T0S  0P4@TlPP Z@T p-@LPP Y40`S C4P3pP& P4P PV00 SQ  R 004\ 00 44P -L\M@ H@ PHKGK|0 `D@ @@ <@ 8@ 4@ 0@ ,@ P/ 00 @ZH Z Z (K|Q Q d0  40 R4 4040  d0H K805 <00 jKc,4Y Vp 610`0 0x0 0Pt0  R| t(t LpPtx 㕵7 |0h00n`0d00D0,P A0004pd0\ `  |@4 0S| HHn0@@n0L P$n 0tpPF t `PV @5 0Atx =`^ @ 0 ,tx (Lx *`C@ ,n 0tp@T p 4d0   Y| Rp# Pd00 T| 0` |0 @4|04}000|0p 4p \0`0|0p 4|@YP4 hDt89 -X1LHMl ᦡ<1X PU 0/ ` W X ̢l0(KV R 0 0 0 R000 0 0 `V 6/h0S0C0Ph@K@p0 0d $n g%c8hPh9 -LDMpPU!  R 0 0 0 R000 0 0 `V 6/0S0C0PU R000  *K\@K@&0 0X $n PhD9 -LlM P吐Kp`@@ 6tb7 `0 @ \` 100 0 M?NKd 0 0 000  ,0KP , ,@0@, 0A T(K,   t( p-PL0S# S 6t 0 @@6`P d0@ bp @4 P 0S@p  P8 -L MXX@ 0 PpP0SsP PK t9c h|9 -L`Mp x0 *PP? \@ 0t "P@, K 00 R= `P0p0 T x 0R0V0S( V @!000lK@?tlKp 0h dp P @P(KU0 @0 @0 3`@tP p 0p0 A`P| V|  P,@,@40U P ,@A` VPP,P d0  lK@ @(0K@#8 lK8P < h dp `P,@d0\Pp0 ,@PPn p  0d0, n| P,@|& `p x<h@hDh p-@L0S S 6t 0 PP0`P d0@\pL P 0S@p @  P8d0 <0S /X00\0//p-00 P`0P `p/0 P`PU`x%c%c p-@PL,`b Tp(^1 @0 CS  @ Q00T0#Sp -P`0Lp H0H P`PU`84 00 P ` %cx%c p-0LMP`U'\0R PU!  R 0 0R 0 S,@K b\08 (K,0  =P000PUKp2c -L Mp 4  , 4  R?` 0 Z0 PE 0`@PD 0 10 0BR0U `  P @ TXU00  S@7 ,0S4 00S 0/0S, 0T0 S, " 4  R R000 սR000 Z0 P P, 呱 ɱP 0 S@, 00PUP U 000004 @ (K 0q  -LDMdKpP @f 1X[\0R XU  R0 P P\0`S @T 0SC0P0 @T3 0S @T, W L 0X0 0 D P70`S P 0S  00 d0 0 =P 000@T0L0 D0 X0 X$K5h07 060 d0 0 <P0002c -L(MP@PP0ASP(KHK `  0`T<0 H D 4 @ Y pP 㳝H0L 0C`S((H(Č(D((D@PELޞPPLٞ 0㢰<0@ X < > 400hS P30 lP0  PL廞@PV @%T V 0/PP/P@ U  P`0l!PqBKx K ,0K21C0b ?A1c0z<hl(=jgfff -L M 0@0 S`(`((l(`P,P RE@P00SAX/ , @,@  . ,Pp @Z `Q 0 70 0BR0`0 QHPP*p W@00P0, 0 0(KP,P EU@@P00S +$E1@4DP,P P,P D 0-40L@0PP XP 0XP oD8000a0h400400hNx;c;gfff -L`R@pP TU C@@TS S *@EE0 0 80@0T@S# S U *@C.E0 0 000U 0S @0`v gP@ @8`U 0S @000 -LM`@pGTPQ T< T  0=p r$K <tlQ@d Rl1S p@ pP;l1 QP180@ Q0001 0  W0@004 0XPd ` a `R \0p40 pU P Phd00C0 00C 0< (00C0000=j( hx;c --LM0 pR,0 \d2@TX P@T3 0 !0R1S R SP  P P  P` R5 0Q 02 0BSMh(h(h(h(t(t(U d `X0P `0aR  R  40040C(K 0P AWP {MC8p240`U  0EP0  d `X0P `0aR  R0P 0 WP TMP8 r 0Rz 40040U0BPoF0Pkhʚ; -l0L PRp`P@8U P $$ $0 ph5 h;cx;ch;c p-0L PRp`Pp@5h07 060d,P$ $0 ph h;cx;ch;c -LP `^p @P0@  p帀 T 嶐$ 0 @0 0o h;cx;ch;c --LMP@ 0U40 ,@ 0@ @  0SFPP 1 0S`V p 㑭3B(KQ+p_V V(p 㺭P7p  0uA ɟl1P帀 0`, `00V PX@t 0C!/` @#2// 40P 0CP$0PN=@ 0C!/ ̇ P P10/"10/4/ P PP10N / 0\ڿ20S?000S \/ -H8LS@0CSH8 06 H8S06p@-@P`0"U@Tpb0"PU0p0" ^" 0S0R  ^P0,0,P"v8H0P <0Q00P0S/ / /0 00S  00SLR@/ //R0@-X@P \ 0S 0S "0 !B 00t8 Q-L QQ/0@S괩((ԩ(ܩ(((ĩ(̩(7P  PP nPP,`0$ lHs9 Q-L QQV$P7PP: P6 0@*S0<(4(p(4(4(4(4(4(4(x(4(4(4(4(4(4(4(4(4(4((4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(4(h(HP 0P `PlP`@ 7n9 p-0P`@LP`RL(8(ث(L(,(0@P`|\ 2 R0Sp<0@P`0@P`pLu89 p-LR긬(((((p,LQ0O P`p9 -0@p 0$@ (, 7LSI 7(P`S5 S6@ (, \!00CS (̭((( (0P`(P,` (0P`(P,` (0P`(P,` (0P`(P,`0 R 4;0\U0@(0,@7S  0P` P$`y0@(0,@7 8L"R  -LdM}@ P'0 P8 8KYx t -0x@S4t Rdx t0 0x t0 -0x@S4 3! P; @   0 P.7 xQ ?0"0Q|0 |0S|  0px 0 K @P`; 0 07 Y8[P70[S 0S  8@KR0(K 0C8 K0P 80[S&P80[S!8@K0 P `p;@ 0 7  1@ 0 80[S= #pK HK P|1@x| (K\1@ 0 081@K  0Pg@0  @7 *PPMU! 1/R! 0;O `p0  p7  6@ 0 PdMU7470 0 @XPd 0P 0@w8@B/ R-L@\0TT 80@ I 8,D < 0Q0bC99 --0LS1p`m Qm1_AP 0S   R_ V0 00Sr  0S .7 1.7 ^ V 00S  ^Q 1.GT@# P 1.'R! 1?0Q z1.GuT@n4 $(0`O8 v899 -7 P`0@0Lp- 008#QQ 0-0S1 p0Q`@WH0 Q0(0 @ FS$ -에0`@ QL@PR  0LbP TU U    TU =P"  00@@T@=  ZZpP 1/R! 6@ 0@@ S  P4= 747 ZZ47# ? S7_4S (G74LSP @P Z   YPu ` 8 S74 XS/P`-0S6`V :pP ` -pLM -0`0P0P U` 1N0S NP 0 P8P 0 U0`= 0R!   7p(7 17 = S-000 0S-000 0S-000  -000$9 -@Lc7> %t"}Rx2 x2x2 xh -@L &0i H1 0s0000|0| Rd  d 10b\ 00St2 ?x2@x -: 061l)8;c<890 0000  /0@-1 @T^* T91T^  T00S00 0000p!00 B4;0s03S 0S00 000S1  :4;0C0C:4; @ @  00 T00S00 0S0:0   :S  R00|0  :4;00:4;:0s030 0 T00S0[04+0CR  ̫< 7.  0>. 0 ? 0/? 0 /? 0 2"/x((@P&t((|((((d((((((((l((((((((((((((((d(/ // //7 00SQ/="!B10b> 0/0 0 == p-NLTP`@@T 0R! P V Pp -L\MP @p`}P)tK   nK nP!hK  HKx0xXX L00 0C 0 H )0CPP -LOM`d V p* 1@^K2Kl08 `V p#H d *K BK\  XU,K QVL@KK (K p-7L`P@9 0K 0 9 p 0R>:0 "#A10a> 0 00CS/|(((\(((((((l(((((((((((((((|(((((((((((((((((((((((((((((((L(0 0  0)S0 SCLR0S 6p0SQ/phphphphH  048# @(R"!B10b> 0 0 0C-LS(l((l(l(l((l(l(l(l(l(l(l((l(l(l(l(l(l(l(l(l(l(l(l(l(l(l(|(5h+h hh -0L0C@S l(D(`(D(D(D(T(D(D(D(D(D(D(D(l(D(D(D(D(D(D(D(D(D(D(D(D(D(D(D(<(zhu 00CS ( (( ( ( (( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ((/Rkz -NLT` @ RD0D0D0>@ D0H . 㣠NT"]p!W 21C! c. QpP@   W h -LDM 0\ 0C0@  p$@`P 0d `0 dPK`0@\l0 h@ ,l@#$0@`P H#H$8p0!,X Sp` : X  =0=4h080S* @0PK :  T K0 80RKS0K-  LK) FK%TK D  B@@K> P s2\p唀 (KX@ =0=4 -L$M@p0 @00L K080 PJKK0K  DK >K h LK   B 2P s5PC 0 0 L0P 0 0 B0  `!4 08@K040 "880 "4<0     /  0 0  00 0@0@ (K= 0=4 -LP@  m00 0-LP 㞟@P 0@0 -LLMP  d `0 Qp0SK\ S0K0 S G0R K QK @R0KH KKD EK@0 0S 0? K>0K=pKz 0 S 0 0S00000p 05K 4K50K0h0 p0 d0`SKl#|t 0 t*d` *XdX"$#h*4`l 11T0 0+|51|1|| T0 01P 0 0G-p#00`400$M400 !0 0 0  Q0 @  "$""40  0 4,4 ! 0 0$ ""40  0 4,4!  0$ ""40  04 4! Ƞ,Ƞ0 0$ ""40  04 4! .0 $ ""40  0 4,4! X$Ѝ`w88G-#p0 Q0 B ("( 0!0##4 "0 "  0 4,4 !0 $ ""40  0 4,4! 0 $ ""40  04 4! Ƞ,Ƞ0 $ ""40  0 4,4!  0 $ ""40  04 4! Ƞ,Ƞ 0 $ ""40  04 4!. 040# 0'  040# 0'!h0 08#X 87 ("H0('08# )Ġ87_   `P@0 4#0#00`w8 -LM7`p8 ~P0 0 31C ` cR 00~>WU 0~>N>,@*0,* 0 9g; -L(M@p`Q(l(D((8K00S0,0K00S00,0KPPK0+0K)0K*0K  <0  g@ 2@T X(K8K  2K 8K  2K 8K  2K  8K -LXMp l d t h p0P  0RSdP0 @R d 00S  P`| x x0|@$$,0@H p#H80@ L#D<P`t0x@ 0@xD p4R` \ *p03/@PT@ p ;-P 0 BiR 0 T 0S T dP vT00@00h@!!R @t` 0\@"X !8X8U$h"H ht E⠐0!1 0 Y`L@K8#8 h TP0paXhp @PX  0@a0g T@! h0X dXX pOP@ 0W 0pU` .P` iX , RPP l p=0=-T-0T0 T(KS lp=0=-x $T d@00Sd000+.1T  0pX0 @t`K0h !!pB-VEh0t@E⠐K0S:`\.XX!h5T+-1TT0 0l@p=0=-T-T p-@T@ p-T@ }p -T -l=0=`K T n -LP@  R00 - @LIヘP0 1!  -L,MP T p L -0PH0 T +PH0 0 fR H 0S TH < < 00 @0@H#4<<_  0 03 00 "880 040 @ 40L !Rk 4 P`0@0LPCo` 8@K9 L wT <0`YgH@`pD @ D@b 00gT@! @OD @   dL0yYL`p @D  0W0pD0  0 VPH-P PfY P& P U`` P   PP T=0=&,H$,0H0 H(K L0CoP"88 L0 1+,1TP P0H@0 S* P-P 0 0 0PLP0<!T @  @0L 0@P 0$$$$ P @ L 0H 0 0 0 T++HS,H1H T0 0 -L(MP pL P H P0` 0R<@K   9K  H圾P ,0P@0 a P *P\@0 0 BiR |@  0S @0 @0 @  fZPPVP@@ PD  0@a0h T@! H0ᄾD K dZD 8P@ 0X 0Up `N,Pp iZ  RPP`` LL =P0=++@)+0@0 @(K++1T  D0P,@K 0 o*0H 4,0SP ++@+@ 1@T0 0uP*@ LL =P0= -LP@  B00 - @LBsP  -L$MH L ` D +0P@0 L )P@0 0 R @ 0S L@@ P D0\ 2\20 ŠD01@, ,4008@K30  5K  D冽L 0eZT@@`0P<0  0@a0fT@! <`<   dD0ዽZ;P`@ 0V 0`Up \+Pp Z  RPP  HL=0=:*@8* @ @(K+*1T  @p< v(P*+P 0 0p<@ 0 #Ƞ#\#0PD00@ 0 0 0 L*TV+@*@1@ T0 07 0 S00RS/S / // -0h.0RL 9h>@0#200   N000N "" N04\0N7 2S 3/0S `= 0`=/0S `= 0`=/ - 0LS='0R=  - 0LS='0R=  -LM7@SP0  0S00 %>$   0<  - 0L S`𯝘 04#1@#"BP2Sp2S? t0202.2 S.  3/Q o - 0LS@𨝘00 $("8{") 21C!Pc`5S2S  3/ZpuR]N5S@P5@( T E053RC`2S2S  3/rh+ -@L h%꠮: 0-LM@KP # P P P K0@K \  P00CS((((L(D(iy8fy8 0-LM@KP  P 0SH)0)8)(@)()K0@K | P0SH)0)8)(@)()P) oy8ly8 -@LAPp,P0 Y 0 0u: PPjYk:0 $("10Y_:`A8!#Z P`A @8# P 1 PI0SF  YA: 048#8! Y05:`C8 #X00 P `C@8#8P 1Y: 04Y1:0 $ 20Y :R0Y:2 P )(*0\ `=(0`=/ LZ0\ `=(0`=/ M -L4MPP L=0L=(K7S ^ 0$X 0  T  8 p0Y40 `: 0Y:0L D < P H @ 0-S@`  SP`  S `pY: 0Y*`=0`=P0S 0SL0P  =0=XT 804$H0D03 H0Qh> HyP"000@0S  <P <0  ^ $x2   [$X2 R 3 777 777$2Q3#57$20Sm Sg 767 !000 L6 1\A@08 #888 S,;0,;x=0x=2H` c=S<` _ S 2SL` XXR`=0`=R+@K  PGPE0SB0D S D | ` x t p l h d X tP  DPj !000ipQ ?@l R ?P00]7SG8;SDt0X S l1 RO 7678XtdQ ,1   Ϡ 0 0R > 0 > 30'  0 Q'5! L KPp@HPH00@  <008  3[= L KP00l ^PPXX0767< cy8 -L M7P`p L2S V P 0R 0(@K"K l0R =0=@$L0 0@P0@  6ꈎty8 -`L!$ 04"48#xW;ھ 1R" 0PU2 d%@P,  0S+ e!` 0S(`PH=0H=0S0S G!pG0PUH=0H=m#m#ꪪ -LM` 0PSp :@00S ))))p(PPH=0H=)2K H1R0SC 0F0f8#8 $#$"Ki!  00@  $@#T  $K2K  ,K  2K2K  ,K 2K  ,K 0SFK(!ꪪ 0-@L{PR#000h| -LM`p!28#8N8 ,0 @P0M(K2>0Q 0, S PU @0 0@0@#`00 S0 00#  MP00  FP4 U 8 " 000 @4`C`@tO@TtO @BPt,",o,N>@2 ` -LM` p@T!  \PP |0 $Ap0 h080X  @7@ 80$Km7S $Ky8z89H(m8 -LM`pP80  PU$=0$= WP P  ㌯(Ko~"@ =0 =I  Y4  U$=5, %02$=5<:0SP@0P @40 S00PY5@38 0/ 2 1C! c %``PR00SRP00S 08 (K&80  30 0@0@ 0 Y 7S 10 #2R8#0 <00 40.  0S,=0,=| 7S 80 0 00; 40Y V Y& YR0=00=7S[ 2 P TT[ TY 6d PW@ 80|(Ko!7SAR0=00=<7S ' P(=0(=06  0f7 < 1 60@8 0B <=0<=P=T0P= % 7 0@TPTL=0L=00@  pPC 80800@@=0@==  pPD=0D=4 P  fx0 00"5 ,0 (Ko} P4=04= ,0 (Ko< p-3@ 2L`\P0 0  "3"0?03 3*2"0\2"00C:2p - LM !0 b, ! l8 #= b 0*"*RZp @`]^020\0,>0 ,> B%02].0`0?0 V0, 0b! a0=Z.0 ಐ(Ko -PqbLg! lMŞ8\@# &80 00  =  - 00c:#: Sʔ 00h:#: S=0= g1b`Q - 00h:#: S  0mjZ7<  -0` L p ^𨝘 048#N  10^80BPU@ 04 #2$8#8"&0EPU@ 04#28 #8hs< -LM$p  0 S 048#X< "!0 b i 1! b!@58 S4 z 7d"00 S2c>  0<0 &\ 0iA@cZ.4 5 , Zn505`u]N, @` \%SX%X0E8?S-@ P <3008 B  0*0 8 ͊ s@ VP ]>2S= 0 3/@P7 %>0>Q ,e = %04 040 0(KQ =  - 08 0b:#: S0 80(Kog ϊ %%Z, < l< l)8%) 0S/00\ \/0S/0S *S/&-\" ڰ\ \ \0\ P\ \ =0=\00{ -`@PL0>00>^w2pSڰ02S0"R 2 0? :#2,. ,. P\20C0:ü2 hrx -L Ll- 8Qp#@`,j ʠ,ʠ \*%02]= 0 Q? ` ]^020\ 0,>0,> -LM0 0p180  c1Pa1@#28#x0Q`40 {̈́00c:#: Sl 0Z.0g:#:  S, :>0> 0 b!QPz_> G*"*Q005580@ c10b 0_>p0  0(KoO > 0 >008#8: #:^ , 80 c1@b =0 ]^ b0*"* _>? 2S (>@P0 (> 0(Ko>00>(KoZ~0pr40  54p005"R 5,  (Ko$>_0$>  0]6]K 0-P@L !5 '10:0; 'B0 [0C\!%#53c0t0d D0u & 64 0&,0 l ,+p00;t 4+78;0 -@PL`! p' :0 0;pp0 0\4[BC$R(8-S0T 3535t0c0u $1d 0!6 1&06,+l 0;p04+t 8;7 |x 0 0|00|00|00|00|00|00|0P0'008 S000'>08<008" :( 00 000 ~< ->LMQ` $>Q ?>Q >Q >Q >QI@K! 7SL8 HKI0KW! EpsL>Q -@>Q \4>QH ,>Q9 $>Q\>lLpP\80 T=Qc =Q! =Q =QA7p900A=Q @=Q =Q =Q.d=lpP.l=Pp Pj1.'R!d 1?008p87S7S  8p R 4p<Q <Q <Q  0᰿p(K<Q <Q2 <Q`<l݌pP!<  R 7' 7 ;4p7P<Q H<QY @<Q}. 0bp<Q 0Q 0CQ; @Rplp|;l夌pPpP;l噌pP@ _P7;77S7  ' NP4p:lzpPǘ  0S774p4p77~+P  Lpu7 :0 0?00? 000?00?000?000?000 ?S S S S00 0?00?000?0p06p47p#500)00+7SO' p!7"]<000=@00P`0S 8lpP 0SS0p021Cc  pP`V@PpG/p7@- 8p㳀ᴁ+p 8lȋpP6A0AS2p'7 ' S' O7S  7{ 20C'=pd7l型pPIK! pPI0[ SN I [L(HKy4p75p0 00&l|@P{ 00 p6lnpP~7 0S7 <4p7r\6l\pPl174p207b6lLpP\0S 757 /4pO5l9pPI7 k 0S764p7=5l'pP77@w 208S54p,n7SY7Spp5l pP@ Po Pc 0 7p2#>1PP D@P 0SKP000@P 0S:   PpP┠E p7K  p8pHK:0; I0KI p757 4p7;7  p00CS"M@P R2 0S/ R r0a ! c. Q 0S0000G0ac00  pPq pPjYP@ 7 B<4p7-]00?0??0?S0?0 /0// /0 /0 /R0? 0S S S S ?0 ?0 ?0?00?0?0?00??S 0?74p67 p p0Q 8p Q4p m7S37 P`0@0*&7 ;4p7ii i4i i$i i i8iii<=jiiiiiiiii$i4i ii i8i8i8i8i y8:;90,8T T0T(8L L0 ($8 <0Q( 004(0/$0Q0/P)O)O)|=);c 8(s0\ /7S4;0\ / /0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R00 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R0 R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S/0S/P/0S/P/0S / P 0S/0S/P/0S/P/0S /P/Q00S/Q00S/!! ^ p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P 0-,HLPT ! P@@T0  R-@L0)2 "0/400 40   R0-LP@00'.40r |2t0|2 048#8+"+ RL05 102 $ 08 40<2 "0~ -@r L Ȕ\0p R< 0p0 -PL@ p[` \[ V @[0S  [00[0 mT= a0T=[@ -@L`Pinp @P 6/@Pho -LPp`7@P Mnp0S  0S 3 #0S R@~o:0S  p-@PL! E08;P+n` 08008ph_o -LPp@`505`VT@ 5S 5 21CcZ5 21Cc]@02@T0P 2S 2 @ 0-8LSP@  080C0809 -hP0L8m 8@PW@ Xp0(48R0V 0`S=W0=@ mn -0(48LR@0(48R p-L@`PPl=0l=  9 ''8p p p p-L@`PPl=0l=   p 0-LP@P 40p0Mm000n0d H 0:9 -L`9mp @PU@ v8;PSDU@h^n -LpPm`m@@D@PnT8;S hHn% -@LP@  0@1h p-PLlN` @ hP"nQpph -LQ@ 08hӹ 0-@PL--0@1@P00h! -L@ h-   0-H/0L000000/0P  7 00000S /000000000' 0=` 00000000 P  F~ 0<0< p-L`pPup1.GpT@p(1@$R@ p0R@'d10@S9 9  L(@R :0R? @ 1# /0/0@@ @@#@@0SS S S@@/0-@@ 0 S@@7   P@@p @@@@ 0' P @;P@ -8\p`Lp P`Vo`1NGT@ 7 0  8p RhQNG8N p` -6LP 7" 87S7 07@PpRS0,;<V@ ,;`S$PW 7 - 0SVp@W1   Hp'16 0008; 7 {907sp0   p0  (8 #1CRP 7  '0S 707hC0C7{ 89:@9 -Lp=&0= d0d  \87 P`0@ ,0  0:ᴇi 89:T9 -`7 LSR R R 0SX  pj@PlU j000 l\ 00SHW)pX)hX)hX)0S003PPX XX '[[ 04;2S  3/ y8 -7LSHj000k00@Qʐ0P/ 0N.R/P P P/P/ 0N.R/ 0N.R/ 0N.R/y8 R% 0S /0 $(, <4!4"<#Q#:Q/@Q/`Q/ Q/0 0@S /Q/Q/Q/ p0   ;8#("40 /.0 0.0C 0/ -(L"HP 0 0 K -(L"HP 0 0 K -LhHPP&$x0 $L&  p@崀 p-8L`#X@P   ;0 B 0P p -(Lp"hPP @  K0 B  0`   p--0P 0`  @ 0#40/L   | 0;#;C40/  0#40/ ?#80/"$ ?0/ p 0-20P0 @P@D@L T0 -"0@LMp0*00` P4A =0 0 y8 0-0P0@PT@#@L %0 0-0@0@ LP0 -LMSPp" +@Kl 0 0  00CSa)_)a)_)_)_)`)_)_)_)_)_)_)_)_).@K  00P@ `5>I&40`P0`S\Z&40`{&40`- =4"#400<00Pa7 R(K00P @`  00@`  00 (@"h  08#h&4  0`@0P`  u00`P  j08  #hP00P00P| W? S0C0P w0 0F  GP A08  #hPx 600 (P"hjy8y8h9< 9 -"0L@M+pK0`P 8 00  0d0C0y8 0-00@0PL00C0d0C00 p-@ TL`PP T000p+1ph9 p-0L` P@Pp00%P  0#40 b p -L hP @P&x 0 .0"(0CT0;8#("4@& 0p 00b0 0 -L HP p`P$ 00$,0CQ0@p  9# #80   00b0 021CcP0 " 5/S 0C50%?R0 B)  -0Lp @H`PP00A0C0" 00 @"$ 2/S 0C50"?R0 B) 0#40 @b@ @ -R0 R S * S $SNȠN4 Ƞ,Ƞ0 6NȠN4 Ƞ,Ƞ0 V -L[ R`p p\L@:W 0<S "00PP^J 0 F 4%0\ 1 #      pP2 7P T7;8# 40 Z 0 #40M : ;[P{i[0S?7$1 ,' 00c0 00  R'  0  `d0  Cp0  08# 'Q < 8 p-Lp@r?0`L(7QA 4%0Q   6PP L(0 S7 00c0 0p7  v -LM`Qp[ P0[ pP / @L`PP0!P21    ' 7  XX)0, 0@006  w 06T$K PR 0"Q00Sw|p)Tp)|p)Tp)00;'80@0 p 0PU  PPP"[  @P=0= @0pS00P&(2 "!7Se  X 0@0(K1  "[1R vp < @ < !!0< S2 08#< 32C0"R`08#< 0<<0021  pPP 00;PpXd000eU8 =0=2 0' 0K     $0  0@00ꈎ < l9 -LMpQP@`z Vd000eT_ T: T" TI =@0=" T @T T \P `0 2@PVHhF( 0P `P= @0=("(P 6 !⑭0 8w`F((8"(#8P 7S `("(P 6 !o0 8U`,9X99 -L,M P` 0@lHP 0@p PD0p ` P` 0@`LD #D<P`0@ HD#H$8p!,,1 S@ *D  L PL @=0= @=0=(K(1S:D L 3P< D {L,  04Sa b04S 0<4.J@"!BbH >@ 00. 40 0 H @0|HD0 0@808L08F E0@$@<`D0@A#DPC <  p  00` <0 a`p|HL08008F E0@$@`D0@ApPLC #Dp<P`(B0@!(pD`#L4 (0  (H08@0 HL< P@ 4PUh 0S 00L H0H 0 $("H0D8S21CqpcH`凮  |HL08  4` 0@$P`@hP d` @P`h0K4P 0@@@4#D<P`  @  0@@@!( #L4P`  (H`~ pgHL PDp 8  0@,@pH`P 0@pDP0  ` p 0@#D <@ P`0@@@!(#Lp4L (,!H6 HL@ LLˆHtL !␪H0$8 0ry8< 99 -LM01S /  0@,Hp` 0@PD0P`p  0@ L#D <P`0@(!(D#L,!p4Rp%*89  (K@ P0:̓! PK? P p@ P  @=0= =0=(1S:@ 48#8Z0 P a b0cP4epX:d d`0X: S 0PpX): `0X$:00S0S^ PP R+@K d =P0SP  SP7 P Q R 0S{ P  0S `@o @Q  0R  00 0  X  P^ P K P L0S  @0S4[SD ?  0@p,H`P 0@pDP0  `p 0@ L#D <P`0@(!(D#Lp4 0(,!01& D ,ş8$ 0& PPI  04S  |0Sp F E0@$@Ap`D0@ P #D<P`C B0@!(#Lp4pQO 0TqXH1PPQ y  P3#  `VX W  0R@@"!Bb> 00 0  |H0(8008F E0@$@`D0@ApPL #D<P`C B0@(!(pD#L4 (  (0@   PbPU\ `0S[0 $("H0D8SR21Cqpc> 00 0 L|H08  0@`$P`P ` @P`0KP 0@L#D<P`  0@(!(D #L4P`  (`~ p  P@ 000  0 L  <P .@K t rP0S 0S P @@T@T@ PP =< y899y8 -L`Mt 01Sp 0  0@,Hp` 0@PD0P `p  0@ L#D <P`0@(t!(D#L,!p4Rq*a b0cP4epY0:d d`0Y# *)0PpY`: 0Y:0SR+@K  P0S0PpY`*X 0S (Kt 0SS<X  pt-P t0` t!p0:M  048#80\a0b $("(c Q00\0S 048#H 0B8S0SS"R 0Q1 !  /   8c P=0=0S0S0S 0SR   0S  Wp P   #} p-@ TL`PP T0 00p+%1ph49 -LpP V`PC @1 0! 0  00S00 00$(SS"(08#( 0S! 0S08#( "4 0 0  C Cq0CB#4Ac Ba0b i1  08#(ꈎ M-LM0, 8 #X40 0@ yP( Z c @ ;8#(@#< 0 ,;1 08!"8 08!"4 08 8714 04!8"8804!8"4<04! M? 0@418A,@&,( ?$KkX400$D<@ #\#pT l#4<[@<8@ FEpDPCB040[A0!⧥8  $K9 -LM` pPL Pc h/1 0,!"8 0,!"4 0, ,+14 0(!,"880(!,"4<0(!!D 0S0 c 0 6 ?$Km![ \80P> 0#40  002<8#(#< $K99 -LMP pP> `c  /1 0,!"8 0,!"4 0, ,+14 0(!,"880(!,"4<0(!!D 0S c0  0 0& ? Ki! @804 Kb@4099 -LMP`Q<  RpP; @c 0 0  T: O0cS  >` d 6 0$KmG!⮤P8 0@ `@40 $K99Q7788772 S-L3/ 0-7l@6h 700!= PQ L0S 7 77707770>7S 2/7 / p@-0```= pWps2S>0>p7S   0 >0>p\0+ pM^ 1@0"R, ?S<>0>p< 7k S00R/k0u -@Lwyh -L M4  8s4p4 ? 00 [`p, ZRi Vf P\X00@  X0T @ V 40 ( 0, 0T , = \G 0P2  0T, \00+ S+ 0F0Z[0[`٥ Y00[` 0 V0A 0Z\000S , 0r0300 (K\ Q 0S\P0P  P\@  -L0 Ƞ8^@pP,Ƞ#h7\S=0=7V 68S,;0,;x=0x=T 08X:  Ȑ0000(L80Q/H9< p- Q` `VLP0 0C0^S@0 0C0^S@TtT`PP\UDphV 8Vp@@$Tp@|9d:93: -LMW`U@p TOꜞ) ))ܞ)h)U UF4+[0R68 '3R'C@֢ 08:;4;p0\@U3  3# #l3@\ßh3 ` 0 T7 0H8᫟0ES))))0ES4)Ƞ)Ƞ)$)Up U 0707 ! 'p& [h2  Uꌠ))l)l)X)w 7S0C0 07S0C0 00H8wywWD W00 06A!~P,;0,;k'0 0rWp00 0g7d 00@ \=P000 07I'8 PHH9999< : 9$9<949D9X9d92c 999,z8 -LMPp480 0@`W 2S  3/32C 0"h#2S  3/21CA@cZP]Nu@5S @5@ T k05 -32C@LM`p*> X 0 2 1:%X 0? 8#O*@00P>  00 k 8h) -LM`@P4>04>WZ>@c40$A$,p ' 0bhX1 0 -LM`@P8>08>W 0pS0C 0 S hX*>( 0c  ' 0;ꫪ -@Lw ,y (H0HH 0j0"<.007$ $0"|2 * Xq))|$)p@-P \S`0/ S0, S(p$ 00S 100 0P@J0Q@0SA PLZpV \0R*@p0 - @0 0000 L 0P H"D0P@ 40,0Bab/LP T耖C@B5010/   [0 R/!0S S01000 % !!/00 p-0`00@L@LPPp0S S 0 [0Qp(0 QpR 20a0#20p -RL pP@pPT @t& 9/P E` -LM4@ ,Kt 0@ @ PK4)@z8 -L M0@ (KJ 0 @PK()8D  tQ 0 S"0!B //@z8-<JQ !0 S080@-@ !X 0lS  1\0}>EN-E8 BS(00"S: 2 1C00 2 1C008GD  tQ 0 S"0!B //@z8{x -LMP4  p  71@D0@9 2K=2K00<0<P&n900 P,K  0 4 K30K1<14 K 0H$K2c -LM@`,<  P p     6K 0K00 2K07 K80K 8 K<0CH(K -LM< @ P8   t0p(07@D@ 6Ke0P2K<`0900  P`0KV  R< N@ J0 8 K70K1<18 K 0H(K2c0 $ $("( BR#fL0S0SP 0W`0`0P#Kd0p0d00PO PT 0 0@@`#@60%c|9L82c9!h(;(4TT 4T43T 3TCK@(㝂zL0CT~6 D6u1<3T 0Tv0(0X0z3T 0TkTn66  aJ50Sm @00S^& !0S %D@ &@@T@ !0SZ D 0SP(. L-J@ 0 FP; K 0 <PJ8KD`T1S  3/PB KT0X0@(00S#@4( ߁ P  h]P400D 0T T0546DE p 80ZR@ec K kzi i #i i@"i !i %i -`QRLMQP2P 1CP 1CP - $K0  0S?0S<1SS81SS40 S1X2U0 1CU- 1CU0 %d@K@ TK 1FSY0 30K4 K0K  0!  d0pR  d@K0)t1U  p@T, d@T' 0 RP 00W1U PK@Ϸ ҷK44 η6`K$T TƷ  0 t1 rDK!康44 嵷6 FDD 宷X0 0\8`KDD 堷F㕷ii@ii 9`àP  H0P 1CP R-/ 0\/R/ 0iiQ Q 0 R 0RQ// -L@i0\\ t0P6 QQ 0 R80T H0T2c!Q Ƞ Q/:8 10: 0/0* 0/"h!Q Ƞ Q/ \ */ \:L0* 01/:$ 10: 02/bh -@HLP0H0 -@L8pP ` 80S s00S" H嬠P-H|0H00 P Q00P0 L`;H XH0S 40S8001R φP t@幞T ᶆ1L0ST 0RH0SQQ 0 R800嚆 0-L@HZPP HP0$ HϷ@0 Q Q H0HHP( R P0QP0 L פH00S 0S$0S(0S X0 Q0P  PL 㼤H0 p-@P` PL ፷00P30800p -LhMH@PT `xpKH`@ vd0P t H0 008Kp0 'l `n0d @@&d0ᴡKn 0 p-L@` 0 \ @P P B00P30(00pphV 0-@0P@LPvHP HPl0 $ G R 0 0 0 R000  R 0000 0  (00C(0H0hIAbh p-@``LP  0BP  $0:P  (`ph9 9 -<L48M,4pLPK`@!<%K 0 Ӑ 0K`<P0K @6 @$001K -LM(@"x\P @T5 000 0,0 @T. JU3S l0  0S" 0S$0S(0`S`l0 (08 `S`Y R.`V  ,0VV!0@ 0(K`, P ,0S00S40S 0S0S0S 0S`,` 0@ Y`80S` -LM<0 l08 < 0 4 @ , B L1L!08!(#Rp!p1@g @g0!!!111 X`08V#X@! U00U03S 0@PqP`F0,4"48#H<0,4 80=P0@1(K   ^P (@喏$p0 <c>c,c -LXM4`K@p Ⴏ0 30K4K0@ 囜PP* d 00S%t@K@ ip` 08 $0Kl D pP$HHᩙ$PD0 82P យP KᘙP>c8* p-PL@`Pp`}P 04$48# X  }phyJQ':l0Q$\0Q(*\ \04"48# Q\00AQ d0 0QS 0QX 0X0\l S\t8 -0LP0`>c>c -QL M@`Pp@ $Kj?0S S *@$ @` `y봀@P" PUP0S@|N @ y@I 04py@Ph`>c>chd>c p-L M$K➅$KP 0R P`14 F$A`<(4"4 KpQMb -LM0Q  ! 00 <2  K  -LM@0 Pp4P 0S A(KU(`T 0  080!PB 0መUp1Z p, pPt 0`S S U0S S@  U@UT# DSSPd`  ബ   |1Z< 1pQ 0 0 Q g 8K0 7 K80K0 8K40 `YP d0& 8K̭0 7 K80K 08K 40 `P` T00T0Au4QPwjpP  0 04PicP>cL>c\>c>c`>c>c*hHc -L30hm P" 0 0S`yl00 Pl0l0`D@Kc  0P`DpK ?0 D0KC K\08# 0 K=K>K?Kr0DpK &0 D0KC K -L MQ` 0SP  K ŸA0`uP 0B!S#4********************t****X*<***p******-P(R 0 P`%uPU 1 RP÷ x 0 Kit X 0P Kit 4 0$A 0 @t`PV, @0S0sp 0 pt뼀P0S~ (:@/a;u  0x0   KisHp0Sb  :@嶘`E;Y?c>cg>chЦh>c>c>cXhc>c p-` 0@01PC e BL 0!0e 000e0 04"40e8#8  $#$ p -0L `RP pP 0S PP 0@010 0  00  @ڦ@D0P 0P0 00>c -@L+T`p𩝈 4 PP ⳦0D#1 p0i -LDMd  h \ 0( 01C\0X 0XP0 *\ @PT0T0 # Tp X"pW00W``VDTh =T gXP@TT0S 4 R(KW\0W`L:L@K ᬧ L K0\ K0K0X H0 Ô@!P 4 8F000T T$4 R ` V` LK  ~ K K\ LK0d  (H0 wP 0WF"*\0d P\0 W@c<K :[Q; [R 0S39 ["200 "S9 K :` F0HK K0KLKTf X  [@ṏP 4 8ޥᄑ000H 00S0T0 \0 U,KA  ʥ90[0S Sa S+ \ 90K@b d 0"P00P0F:0[; [0SL@K  L KP h0K0KH vP! 8 㙥:0[0:0KX:0[0 0C0K ㎥:0[0:0KT @d  (vP= P  8w` 000dh 0]\0 @c\ 0@b :0[; [0SaL@K ᪦d0 (0K0K,0L KH0 vP :0[0:0K\  @b\0 @cd0 (v@wܐ@r>c>cchlh -鐀L\p`00S 0CP\P1@0 00\00S 0CP@T货h>c>cclhh -LM0@KP` pd0 00K/ K0( ,0 |@ڌP@ d \1 R1<1@` \0R @31   0S 0S8 <#<R K4R(t@TQQ 0 R80S, ^ 0\ 4S ^8 #8S8#8R>c -PL00`q0S 1I2@T @T 0S 0S 0S 0S 04"40g8#8 $#$(!"(  $ $)"(04"48#XQTF )딡C04"4R|!`00`0m`PN PDq<@1  Q ; ݣ Pd00d0 000 `P`P@00@0P0 0$q!$ ("(04"40ꀠ40040 x0t0 L 0  d00d0 00 0货hc>chhHc -L< }P?c -LM pK $`K @Ÿ 0@h|Ÿ| 0@` WP LŸL"0lC1@   R(2@Tl4T40 R0S 8CXU !L1ѓ4T41P 1RPUA)"("(0Pdd210: P4A)[P "("(0P[P 210: P 9 5 1@ Kh|0噌t0l喬Ƅ8„89h9lhHc>ch"h8K8obh9h9Цh9Xhc>c9 p-LM@0  Q0e ` PK  0S S S! S Kp !K 0S08# 0S  0KW08# 0S0![ 08# -LM"2P0Sp: 02K00a 04 @"48f#8!,# $8#$$. ,8#8!8S0@3l05l0#5l04l0#3l03l0#1l00l0xqR@ ƕ@ Rl0l0@0@0@@l0l0Rl0l000@@l0l0Rl0l000@@l0l0Rl0l000@@l0l0Rl0l000@@l0l00BS@x ƕrFd2@ x @q @Rl0l0;;@@l0l0Rl0l0;;@@l0l0Rl0l0<<@@l0l0 T T"TW 0S0PU PY P@l0@00l0\1T0 0 0@0g0 @zW] 0S @00r0S@ 0L  0@PD TTP0 0 l 00@. hl0@ 00l0?l0@0 0l09=j!>c -P p04 48`G#8SLE*0S010H fP<*@P5 0!0 0 @!400 0p000P p  P@ ښp 04"408#8 $#$  0 0  0 šph -LM`< 0p01 cX80 J((K 804"48#8P, @4 0 [0 408`04"4:18#( 0 :04 0 $#$("(Q0Ա40:0ı0c 8#8 $#$ 4 0P ,<0 S04"40 <0 P0SA "x000x0q4H00H04 04"48#8S-@FPPL 1P80 @@S00!1,(D01(D0 @10 0 0z202, cr,8#8 $#$<0 S  <0 PP 8x00x0<\ <00<0 00p{W7- <00<0202# V8p( p/pp 0S0S/p0(0p-pBp9p0 P p P p8gP1pV 0 ,)0y`t0@c4@ch 999 -L@`@81à PddUp!@0P0@AW 素ᶐp( tf/ĕ|Q QV% 4 #V 01tf㕕 (㑕4<㍕tih@-@1M    QP> (19C8# ("(8S 0 Ӵ (B(R bA9C08#8(R00Ӱ0Ѡ =0 0S01AS0#!8#(B8 CP&8!̱P ü&,0 0 20@viBN|1S(  S < t0b? S / -LM]0PS S, /(K 0, 40 0 (0*0S`` @ @pP7 0D 08 # R+&1 7( 0<, 40 0 0` ,`0(0 4]P P ``d ה Ӕ00%(@ 72 <(4"4!<0 <(4"4!<,0 0 0D ("(04"4 0 ;#40+ 00S  <4("4!<0: X2T"0X0 <(4"4!<0T <4("4!<0]0SQ S, 0b8#8#!<80 #80!010bB]0P|SB S, 0b8#8 $#$(0"0`0!"(0 ]0S8 S/D 4  0k`0@0| 0 0 % 71Y,0 c("(04"4 0!;]0^40h0x0 q 0  ]0]0D 0S;04 *h @c>c>c -@Q`RLMQp % 02K R RP VPU00U0SRF R R @00`eV00S RU 0BP U0 0 㭓<( 4"4!<0 㡓 <(4"4!<0 0 6S-t0`0@1A : 08#8:AQ00Q000@ H 0?0pi$@ o<@c@vi@c;Ls* -,$LM0P"1@4py#, `V 0S䣟]0S S0P0\  0!0# 0 "7! 8 00#P P2C `L3H` Rv8#0SM $3* ! BR0 0R000@X "0?0Dpd10Sd!00dQ00   P0P00Lp R?@0@PH1LA 2 r3"10"0 R1,o1$> 0@`1dA P@Z `F\ 7  800# "P@x n^? 0@x1|A @=#},,!0S   0}6P  0 "!B50 S0  000 S pj? 0@1A2 1CV0 @ Q!@ TV@huiui@viX@cT@c@c;Ls*P@c\@c P-L@ 1T T \,`TPl0'@(@Cw`<0T!Pl0<@C m`0T!;@l@c -LM@P! X D! P0 1 dqK ` `f! :X.0S&  0 , KPP> cb? 0@X1A P b묀p0T0Pd @0 0@0d (K |2| t2RH (K  P! 0 0$ 1 P  㙑pPx  \  x0 Z 嬀\00b  ] +O 0a a|S0SD0Dp0T0P!= SA `0`S$ 000  帐@P  d @0 0@0d 0@P !0q [0 20   0 p0R0P000:0:XP!X} Y@vit@cti-c -0rLP|`@Pp `w_P |!R2 R(0 p\_X1ų10S S03V`!t@V@!@@3b/ R8 @D#h.8`#hx$ p10S; S AgL!0S01S 1 \P R8 0l@Cx9 l0 0lpCWp1`0%Tt h1l1 S 1% A5pg6R R @x0 R0! S 1 !T0 R l00l@C PNNl2@2:^p`l@c2|@c9>c -|0GL`@p>PPU:EDp0R1XP𨝘@680PR1h>X@P𨝘-c -LMpP  @0, K0`P 0 0R Y! (K 0aS0BD 0a0bS! P @l0l <0 l0w 0x00w x000030S S,=0S H 000 0PP 0 0 ;P Po rD@D0t t 0S "2S1 `0 R!t0:t0=t0Px X0trX1T lRT!00 001006@2 4!0("?08m000;So: S7 100! 00&?0lD R1 0cS!`> 0@P1TA@/P  0(@0 @ LY *0@P !0 80P00@  H Bl0 PL 7K ;@vi@c<@c A-L@J 0\:@T 0c 0bS R@TH備0D L1M0L1  l BL 00C 0$9 -6| 8SLP@p@T  0S  ȐV,  0@S&1 `0V 00000 U  | R l0 0 P HvP |0H2ot04t0t04t0yi -LM`0 ᐎP P  00lSں 00lSpWP, $ 0! lPU0U0 P` 0O0@0@R OM000e0     0/8 4 0 W  1QS P, R0000 0$ Up 0 0lQ0@ @,P尀U㲁 ,0S0,   0R (K R 0` 0R(Ko 0 Y  0R; $!0000 0a1 0@ @,P尀U㲁,  0@_8@ 4P @P@P@ p 0,@ /8 4 0  s R0000 0  0R yi@vi --LMx00 4 x0KH 1 0#2S S  x(K 0R :Y 0@`jT,` TPP P  2 @10\1 \( ,0:@T 0,#21S  S R0 000`n^,` P<` ,  H $0$$@X%4P,̂&.,%    R R B 0P0"!U00 Uq 101P=P LcdP  ,`,``,` 0   (0 d w  80KP 8 0R:0[000N  R 0S0sA 0S0S 0s7 R   0S0S0S+ @0S' PP <000  0R0% a:Y PPE UP  @@ R 0S PP M p;R  G  CH  <(4"4!< D0  <4("4!<@0 00 + ,0@ 0@\K d@Kc0K嶊0xK @KK0K嬊@GK0 ^  ^ ( ` 嚊 <  㖊0, 0 R`02 J@TV \ 9PU 0R{ @#3Rd101 R |0@  @|1S SPx9A ,@@ow0 00(, 0PU Q Q D^ \ ` P1#  @ 0 0\41ʴ@T H0K0(  0 )PHQ @P PtȟX!0 b0b S0@ @0 \ P@dPX`P a1 n0dPR ?S0 0,1(1\ \ \| HQ 0T!R D00bS0c^/V !R0B" N1Ɂ ,0^@< 0O0@0@00 0, `n,` 1^0n Σ 1ɱɡ0,` ,`6VSʨ@ 00c0a0PU0U000O0@0@ RP 0R P U t0 0t03 P @ 00cS10cS} U =% @ 0(P R 0S* R @0S*dK.K+0S Sm 1P0P 1$0 ?008'h70S @0dP`XPP0S#HQ D T10bS00dSڨ@n199000 0K { V101 00cS10cS0O0@0@e9,``e ,` H0S DT10cS`!0bSHڤPL  `1R 0R 0R?6 S=&02 '+4 = #P 00 0C %  80K!P_ 8@ 0R0% *宔 @Pt0PP t,0O0@0@t00@0d0Kc@K ` 0KK@K0|0 K  X1AQ T!D00bS;0 @PR00U0S% ^0S*Q `10cS 0\1D T!,0S0 P 00cS0`S 1S:6S  dP`XP @vi@@cuiD@c viPPKc89zi-cuiH@cuiL@c8@cziui;zilui@cH?x@c (\PU ( PVi U 00lSf00[_ 6S7 1Ũ@t0 @UAt@3 0 0bS.000W4!0 p aX pʃd XXp M r0 S X RY0!0bS+0ODH0@)H0L@D5pP `IX00S+G1 0X0 0X0X0x 00 0 10000x 0S0 (p  (t00t0pP lHX00S 0X0 0X0 0,0 x0S Ҁx0 ` @B t0 1R B X40 <(4"4!<0p <4("4!<\06 X0`#P7P` 1Q!0\ a7`2 S 0S0S"("(\0 04"48#800 cQ0ՠ0 ڸ& 0Q 1("(" 0 0202r R 40 1 0cS!0|0 ( |1S S S ("(04"40| @x00| q0%00|S;0H l@ ft tQ5l1l\l@0\0@0t` 00 0t`P  10cS0``!t`dQO 0 S   4X0|0 T ,< $8 #$,,p.T0K,A  4TK 0T| p ,dd00d0Pğh00h0t0fh t`    Vt0 `t` 1 0cS 81!S3 <8!0000@ 0R #0?0^40X?0S< 09406/20@(0C8#,("(#80 0l 0|h/|H 0Wt D0 p TKnp 0#10 " 0t0R^Jx 0PPᔸ7 t 1@0S0KT@K 04 4(KTK 0a@@=t` & T"R1p < 4("4!c ;Nd9zi0R1\R!/0  Q/ 0-LEM|0@f Q 0S- J_K  ~K .|> .|< .|1S# |8 .|( .XK0X0T :0X!K0\L1DH .00|, .| . yiPxizi0vi p-LD@P`P00T00Spd0phM -D@LPpTPg d0 X0 00h0W0'P7S -@ML0  0 @ @IK*8zi -L Mp@Q` (K0S PPQ 0@SŸ3P8 PŸ. P+ U V' 001@0 @ 0Ls Pi @0S D^ < ,$ !$0,0cS10cS  01 RV @ 0@?P< DZ <,$!$0$L0cS10cS`F0l $#$("Y* @h1Y,*t05t0 p10dSupA0^/t10 00j3PAP @Pd8@KS} P8K@7K` 0cK4P Qt05t0<0X?cH)*zi*>c* -L(M@PQp` (K0S0SJ UU 0ES៕LU UG 1 R VA 0S ]  0R:<K}  <0K[#[P0pUB P3 @08S D^ < ,$ !$0,0cS10cS04 0S0S s嘐 0pP 0SL03PAP @P < K0AP5H)Mc*8zi -LD@@68C8S SX06cOh6S(0 R3QAQ@QN 0-@PTL0 R0000 0  @T0yi 0-L@MP 0000$yi@vi p-|P@L@`t06xP t06t0 @F[D@<Pp0t0"[ p-6| SL@P@`h 000<U8#L00S8C88#ph06 00 0@viN - LP}PPpN @p81@P0.@7 Za@@ ZT  Y 0-S00t00| " 0C18#8(BQQ/6ڀQ0ü6p0 $1 1h!l!l  00|1|1 @0@0  w x DP$yil@cp*̄8*t@cp@cB?Kc>c -L,MP@ PL0 P T ||0@ @ H0H0 Pd`X0`0lQ< ᎵPO 8$0@ R RG T P  @0P0PP 0 0 0L0LP  ,<$4 !$ 4),%c>c @c -@xLP|P`F |P4 P@, Wz Szp0:0`0#$#  #   0 !*0(@# 0 0S 0 0 P P1 00 001@ z0+ 0 80 0(  0@Ỵ`P |1S S(0 0 S0 0 0D 0 00(0S+&1p6`h 0-L M@PPf 0@@B 0@:x0 h09zd)\ 0;S<00L 0<0S<d;K0h (zip9$yix9yi@czi( hh*9d d0S=0T 0S00D 0S=00S/( (0?0c0/zizizizi;gfff -L| 4@440 (0!nj h zi@czizi 0-@Lc t0P6 S `0P T 400aS0h , ,0 ?0PcXzi@c;zi p-L M@7 t0`V% 40040&(BP1 R|0@  0 ?087XKphS <00<<0KphI Pʄ0^x0l 40`0Q*80 080x0LPP_ 0@vizi;zizi@czi -@L t0p0 h ,00,0&= R P0` p0r00r0p04h0a P * 8(C89H C1S01P:000<00@viB@czi@c 0-@L t0P0t0i0h  -L0M` t# |^ p!0 RJ70cS608#8(R62 &$  $ 0S8<C@  Kr(0-0(00 h1C1 S01("(8C8S&ƱS0ü6 "0?0RW2 R$ |@T! 6Sں6Q@0 R P d0 X0 |1S (PP X0Q c6Qʰ0 G P!P 8QPV$1 AD10D1|-0100tD [5t0K^?0 4KDK(0LK40 0@Kw|0 00K/ K(0T,0 (0D _0X0@viNB@c;>cz*zi 0-LP@@@VT0 p-|0L@P@X`P 0X V`!P h0R:0V`1VpGPPDphP0\ QX`X(!10bQ0 0`V`!@c@c-c -|0L@P`@P! 0 T1!p00n `S0S0\10S0GD Whg00 \!0 `\!@c-c -LMp`WP P0SR@ Q㕏K"! * @P 0S:QR K/㌧@PS2[S S @(KUKS[P P? B8K 'PUK HK'@P  %4 P4 P< P6P1 P, ̼P'⯿40 0 0r 44 0Pr0  PPm R 0S0S0S 0S R 0S0s  PUP p 0S mP P =7P-c@vi;<@c9 p-L MQPP Kp0S S S S* 0PPH? 0PKphb>T `0 R TD4 0PKphN>  0@AcBhg {ih -L0M\@ D L H0 (P# *<K sHQ 0S P H(KY 0S0`S/P0S1P D (pW8P,KD RPPD3S <0[S 8 R D80R #S#K80K,0  㖮PP7P @ r@ 08#8 $#$  ,0V s 00D031L0("(D04x"4q01 R202,0D0,0H 0(@0D 0D PP4P~ ` Vw@p Ts00V*n000`Vpp Vf@0 T0`S^TPU0S  8Kq l1D<K<@K;K/PP GD(0S9PB D `80,0 qD(00T0@l!D PU)L$<Kl1 DPP Q4Ac {i=j -LM Q@p`" Z, P0u03T0S"TNL*L*0*p**p*****D** **p**x*p*p*p*p*p* 0 Q  0o魹@,k ڪ ت<P@  0o-@l0L{ 8@l0  0S 0S$0S(0S^ 8@;}l0 o 0S 0S$0S(0SI ,r0@00U1 5@Pxg@Pl0 `1`1  w x l0L1 @ս@,-@l0 %   0n@,,@ M@v9@t@TnWk᩺gac  0'@(0S 080(0S὿@9P88Acc -QLM 0S K0S0S P0@ SAP T \  0 0HP0P @0S   0??cH)@{i* -@0@L@H@hC --LPM000` 000 , 0@#2S S/ ©,(K0c0K 0 Sp p *:W 0S000 0V $#$("(8#X 0 dR' U00U0S 0000c0K 0 Sp `p * 40KyPZ 4 0R0%p *|bBHK0Y0 0S 0S0s 0SU 0Sl0 : 0Y0 0cP[Ut U d@Ko0d0KcPK06K1  7PU h l0  W@(WT< PU @0 Yl0 000c2  (0V0(0I  0㺖0S 000H0S 0sAY? R00d00dSPU`#0RYl R 0S:,0S00S40S 80S0SL 0SI$0SF(0SCh0S> %0㗫@P7 Y h0l 50Sh @0   h, K3V h0l 50Sh @0   h,K 0poh0dK@ P,0ɼP0ᙨ,嗨 00 00,0 @0 6 hP VY (@ 0@勻PU Y R 0S:V R 0S:0Y,0 l X40S@0   , Kw3V l 40S@0   ,K 0kY l0  ,0S,@K @0S@ )06V l0  ,0S,@K @0S! 0#p@dKP ,0JP 00 0Sh0S} Y h0l 20Sh @0   h, K3V h0l 20Sh @0    h,K0pấh0dK@ P,0P h @M!dK=n0d0KcPK &K 0`0 , nPY  0B $0"!0Y$00L ( 9PU70x00! 000YC l000 .(@  0 @塻P000@ mPT#0RP R 0SI:8 R 0RC( R 0R=( hPh @ѱHK00l  0 hP ? {i89@{iʚ; -Lm@{i -LlM@Qp PU (K`VP0@Sl iPe P 2 R W 0x S 0t0 p v L0KLK0 omKPKL`KDK| |x ,4 LK P2l0 Yd xt 0R:0@KNmh`K0 xtE@`PKCm0 g0KhKBmx ,YP ZPXG ["[pLK l08hl pLKL KD0K |0 DKLK 7Px p uDKLK (P hLKD Kl  | tl pLK l \0T.Q[DK"[0(効P%H)Mc*@{i8-Q@P P*R 000P8 0;9l{i\Ac -LMP)0Kp @ᦥ)0[ !#R)K R A (0/0(0(K%aVT 5,  , /001S %1S L5,  , 0701S1S1S ,1S Q ( ۨPk$700001S41S81S 0SN S 0SD S00S S000(1S 1S  ᩨP @ @ 0 000 ("(04"4#0庐(1 0 ! y04 40)[Z Z ᮥp#(0/0(0l00S 00S0 0 0``000I(0C8#8 $#$("<8"( #8"000 B )@[T T` s"(0/0(01 00S Sv) +0K⻤@0+ K*K*0K  0*[48( <"4!<#,## 0000 1S S0 R0 0(0C@0@0@0 R00C@  00C@0@0@ 1 00K(j00,<$"*)0+ K00(0C@   00KR00,<$"*)0+ K 0嶐0+ K*K*0KA *0[0 +0K; 0 5 04"48#89C40l{i>c -LAMxdp +0KP+ ["2S S (00(0峤(K 0S :"2S S 2w( 0S*VPP + ["2S0 * K]0S000劤 04 8<,<$"* * KD0SWQ )W( 0S:W} )W@G ,:P 62 R :KK,lX 0 +1K,!K 0(1 KK( $Y@P d0QV:00jO0@W0@u )W,BY LP  0 1f6P 00 0n @ 04 8<̠<Č,ʠ*K) K)K@ P>  048<!$!0!̠ 0)0[:("#! !4!(0 *K 0)0K  P  )0[R 0 0Q@mየPPc000 00 0ȣ00K@X`@$00$0帣UTc 0IK +1K,KjZl{i9\AcLc?c -\0LP1  0 ($ 00 0厣 \Acl{i --\0LM R1   00 0 K 00 0l\Acl{iG-@0 0P8< 0#40   0 ! 0 8<0# R M` *\\\s\`B0P3P .0.. " A1 "4 " "  " "0,`0 (V 0 Ѝ08 <0#40 (0, "V0```r``F0 0! #0 042P .0.. "1 A "4 " " "0" 0 `# V  08 <0#40 (0, " VHHHqH  41,!(1 !1! !!, ! !0,0 00 0 P 0.(. .A 1 ! 4 (  0 .,0!$0   !80R0!L`@ Oܕ8ܙ8ܝ8ܡ8ܥ8 -LdM`AT0 2P 0P0 0000 0@DU 0 N0Q 4, 0@P.,4P l $( 4 #l!<` 8 < p !Lp @ L ,!T P T `!a$|,.X |` l ap#Xh P ` qp !8 #4P!01@P@,Ġ Q H0 .P0DP !XPd 1hQx !|$D@1\P `Qa@ 0#pq "t  D@\0  H0@dP!x0At0 Qt`p "`!0',p !0p  "0# W,p  0v0(Kܙ8ܐ8܄8܈8܌8G-Mhp`@ h@$ P` L$`\,` , .\ p &`PX  ,$,X. .  lH$p th $d0hx ̠|pPQ'l !a4PP<`, P#<`P|0$`p *L#x0!`@(0 $@ 0,@x0h@%D&T#d<0x!40p "0.Ƞ #4*q 0pp,(8! p "0.*4@P q T`A8`(P!0` 0# " !0# `l"p0t`pl@tl p!L"< ⤓! lT #3P Qa*̠ !pLDP`l@p$@$pp0@#t0 @0pP0l0t`#D0*Ƞ0%0T0  L0!D0&X "0P #Ē0 QPH$ @P !P&dp` " 0%pb@Pp*Q @@ a Hp 0# " !pW  "0#px!| 0 %xp'? A10N@b@P, P0@ R?W@pG 0 _?W@P0 W(K (Koa@, a I,0!pc?WP -L$M L 1>?0@0c40 S.,0.D < 80 @0 L0 #\##4pmvmznܼNS @L❀fm 00@0#@D@H0g{  0  Pl PM舂0na0 P0#    P T0` 0fk00#̎00i$ 8Pl1 X0  P$0 PĐlq dK 0'b,p hQdp` P} 0P `p h 00lˠT1P $Z g{0q 隁 0ppfKXa0 $!@ 0 @@Pa018Ba  n @ 0@ a0g{ e[lp @  0@p`dI 00 0 nb)h0Hr `la p `0 01lip 0  la dKa pPcH0gy  `0`h P 0`l 0` P80hh  e[ 0P 0T P 0 g{XT˄  0 aP 0PP0a8@  0  hDL1fk e\ ᜐ@ 0@ 0h@ lˠ K Xp! `0 l! !0p l0e[p  ab*  pL0<` ༐  0` 0L!`dK 0}  Hࠕ00! b+ ! T1` ` 0e0i  0 `, 0``L0lʀg{Pp a  T P\vfl0   0p0p, pP0ig} @,1lA l1@Pn 1 @  Pfk @P@0H` 0Wl1 0P荁Pl1  00lˠP g{ 0 eZX0 pP `  %8Pj0$ 0#Wh0 PdKPHahnਐ0*0#  gT0 !P`Xj`@pì 0. 0#  (xT1 %`pmnpX` a0,0# @ @lL0 &pe[zlˠ dK 0  0# fk '88 h0  (` T j0$ 0#a`0g{dKHP0* 0# h )@Y@0 P i `LP !lɀ` Y0jfj 0. P 0# &PnPP ` 0,a0#@@ d0yflˠ ``dLp 0 0#]jX1 %pp`gz` `L꩎0$  'e[ 0#` H0d g{p dK0pin0* &0# P1h fk (  ሀ hpPj ̀ 0. 0# !0hq 0`[\b,0b;(! 0`Xq n0,lˠ@ a{  0#T@I`!  0P!` ꪎP$0 P% 0: HQ 0 (夀,`L;] 0p0Da % 0dc (K -0Q^q?`p@PfUpLpV@@Z* Q( ao.Z@ @0Z* Q(@ Z @@Z`* -L$M01>?0@0c40 04L0 0^#<<0 8 0@ #8D0 L0#\#pT..l<[#4)KD[<*K4/0K@L04 00K40-PK C.KP H +K,pKH0K  U 'DH  0#<0 "( 0#40  Q \Q? `P0`?SpP`0L`@  goS@pb@ S C?0YP@p ;?0Y@P 0 -LM`Pp(K  !62 b1 R<0Q0^ ~?@ Q R 1  !1PS\S K98G-M 0H 0@ 0 P$P`(`H`,P  0p@  00@L ` 0(, 00($ 0 ,@ 0j0!(P,@ f 0 @0 P.!T,f. 0$0@P0L0(  0,P$ @(0,@8`< PD08}PZ1Ab_`j?qā^f> AfoQ0@^ q  0@N01 joQ0@bq  0@ߍH8 -pRLPD@A1>0`9W@;@ RpG`@D  Q*H0 0@WH0L@WP O@1 0S@DR𭝘H0 0@H0L@耀cWP20:P` zO@1@ T@D  `phSH0 0@H0L@ -pRL`D@A1>?0 @c WP20&:PP FO@1@ @D  pj?W@<@pG@ ?W@D @WP "O@1@ @D 0-8PL@ OP `P@0@0D@H0L@08 -L\M<, @@H l h p P P 0 t p0 t0 < lp p0 t t K @KP0|0 x@ H`0 4 0 lK@  L#D,<4PK`!$P`t|0K, @^ 0 (KT 0SQ0PM AcUUUUp888 -L MP@`pP DHL.$ . . Ƞ,Ƞ  D,, ,4..D, @.$ @$.`0PK p@$,4  0 ,@  v 3 0,40!0 0##$ 4# ""# !"!!" ! 2!26:0#`p4 P!@!4 ! $ 0 (K3333UUUU -,0L0@,0 << ! 0h!l|i 0-L M 0"0 0|"xPx0@t 0D@ELPEH h0@EK0hE9l|i9{i@}i9p|i9 -@PLd0 80C8Q hCp|i{i - Lp`A`P W P80Ud08@ ( A@PP{ip|i -@QL^ ppW`$P0S #20 !   \P0@0 0 000  @hBcdBc -LMⰡ00 SP? 1p`^0 @0S$ 0!/ V U 010 R010 R PQt #200 R @ ^t`VX p(KV ^"3(K0@ pP ,P0@`@00 000 dBchBc p-@LPE0` R}pQ 0ES#2@1 R U 00  Q 0 S Q XpP ?U( 00  PhBcdBc -0Lq0SK RY|PPU 0S00S  00+U>l 0`P7 @3" >3>#200 〠 3" l000`l 0 p<0P  PP PhBcdBc -pP0LS`P @VP#:3"@ 0S0C0000SP 3/P0  0S =dBchBc -L MpP] <0SZ O4 8QU 1PQ |1 PY`:d R 0`0d R80K oP00K0@#0(04d(K3 " 0.0S  0@0/00@0 @|0  P p( 80(0x4- U8dBchBc p-0LP` 0S@ *x 200 \0` V ,0 gp $rpl|ihBcdBc@}it+Q@-@ \0Q  P 0 SQZP00Q0S @10  -LQ`.R.\V&  \* V  R b\`FPXVp`V @@lT@!d l=XpIII IH9(99 9 -LQp`-R-\V% 0\* V 0 S c\`FPWV`V @@lT@!pd -=WSIQIOI LI99\9x9 -L`R?Q;8 Rp.0^p.W& 0Sc^pV WQ pRP 0 @nT@! :/P`dV(I IpH H9$999 0-LdMPP#t@K`<x x0 p l h d ` \ X < 8 4 $ T P H D @ 0 , (  K0HtBc<+4++P9 -P1L PN@0SJ a@ TE P, 00 R0"PPU.Nx!00S PP ;l eP ; l\ lX0@ T0P ; lG P ;l =pBclBc1p8 -P00PQ0SLeQ^ X0S  X"00l 0@P`uN PP  !< !l@1S  RUa 1`l +P@D 0BSDd+\++++l++++++++++L+D+<++++T+<+PtP l @P  R0 !P0p@ PPU `l P@7 30 @ PPU`sl 0P  0R !("( 0p@ rrrrrrrl @0S l 0S 0S 01S 060#0 R0 P 0R !("(  0!S0!B("( 0S 01S 0j0#0 R0 P0 0R !("(  0!S0!B("(  0S 01St 0\0#0 R0 Pgpwpup p ppmpkpip00@ p0 000 S077@0lBcpBcCcPCc EcDcDc,CcHEcBcxBc0Dc808DcCcBctCcCcDcDcXDcCcpEcBc -LM@`l PpPa Xa 06 0L( KlP UL P 0 0U2XJ  (0U(*XJ e@A0?P00S 1\1C40A\.0@D0 0l/P  0CR0(l @$K( K lP 3U0*s(0 bw 0`0`q -LM8@0T8  Up4 0 , $ ` 0!R 0QQ  R(KQ01Nu pP K 9$ d@T4XQ ,0 00 2   K94 0 Q" 4"80K /0S ("(KK3/ 0 0`hK( 0 Q 8 0U 9("0 (" `Q, PCdf9 K  0PS`@f0eT@ 2 S80{r1~ 00" ,2 `4B , 0S 0"K3/42 RTP0," ("(K  Q9 4"8 0 42$ PR6$@e T @ T Q 428  04 0( "(K 02 , '94"8 0 r4" 8  0Qv0SS(S   9(4h 0K`0   @KK$ "R- @ 82 \5 428 0K 8(" <(4"4!0CS+++++++t+++++++++++++++0 0P(0 0d`V 0@Tu(00 pP( 0 0GP( pBclBc////0 K0 H (-"(L (-"(L (-"(L (-"(LJ (-"(L$ (-"(L R@R-pLP`A z ! j -LMpP@,`K3 0#0P\#  O0#0#0QA#0P0 Q3@R3x 0#3r4K  0-LMP K4 !4<"D\0 @  4=z K0 -@L 4400 -@L 4h4 Rp-L@`Pp! BP @ 4p 0-LMP 0A00S0 B Q$@K 0w0 0#0Q3K0 -LY  I (-"(L \ % 0-PL@P PP00 -@ML0,9K - ML̀@0@+K -LMhKP@ @pK4 00 RX  Ta1*080 Ÿ2l d@ < @0 hP <P v 0XP0 ` X T` X"@TŸ0@ QIQP00h@KP @Pl  PVT0USPQ V`1P @I 0X 0 `T` X  JPl P0l 0 P0 XO H0SL `pK0@ 3000l `e0 pS8 0PU :@3000l ``y0 S P Pl z0SX G(K =<0 , @0=y =3131Ec|9Ec -pLP 0   R`@0 0` 00Ố@ T000@-pS`P@0 000   000 000  " @Tp@-`RPp@0 000   00 0000  @Tp0@-PQ0@  0 000 0@0PU0@-pR`P 13 RP@0   "  80#440# ># b1#  @ 0@^ 0-@P LX 0#40 "( 00  0#40 "( 0008 -(0 $ , 08 40< 00p2 -@Lz 302 -LM,PK` p3 ,[  V 0R3000[00K–\< ,[  T 0R3000[00K 0Q1 0Q11 0#P1@1!@0#T1z M1K1 0#P1  0R3000[x 000#0K  0R3000[x 000#0K -pLP`@~Vz_1 0#P1`F V@  1b0`R1!~ 120VS  2𭝘1!0#P1z_ `h@ 1 -L@M\PK`p7@~1!}1@0\0#0@@T  0K -@RL@M@P`$p  01\PK@I1!H1@060#0@@Tx 0Kp21A -L@M\PK`pQ@"1\ !1@0\0#0@@T`  60K -@RL@M@P`$E\p 00\PK@0 0@060#0@@T* ]0K\p0@ -L@M\PK`p@0X 0@0\0#0@@T  /0K -@RL@M@P`$Xp r00\PK@0 0@060#0@@T X0KXpx0@G- 0$M0| l L\ ̠<Č4HX p%Č$h Px (*@&'4@%l,| @@ @ 0!0R#00c4  b0 0 0# 00P! 0#00ϠO!Zp`ᨀᩐ#`p @ <\ L4 , $HX $$ @%4,P.$ &',)<$Ѝ p-LM@0(`K/1P00.0 0@0#0Ql/Kp -(LM"X0`Kp U@T Kd / 00 d0T 8EcI?("(/ -""LM 0`, 00 P" 000 @Pp 00#00  "  0p0#0 0  ,,0@W0 (Ko/ -H$H0p!`L BP@0D p/0 0hc -@La/^/ [/hW/ -L@MQ@d ` 0Kh0 R/ N/h@D0E @H D  L@ P h0S H@K0`@ \P LPT0 XP 0K @K5/`K``[\0@$L`X`0K@0Lp#D <P``0K@0D#L4p `0K0@#4<$D,`0K0@#<4($LP``0K@$4$@p`0K@$<@P`@K8K0!@"X @0 <@ .d@K@ K@K 0K.8K X.`0K0 @XP`0 \@ T@PE@TT@ XP h`0F@HPK`PU`P`HP D` P``FvP` t@K3.0K ;.P(K8 -L4MX \0  X0H T !H.< \.H@P L <@ D @ D@XT @H 0Q@ < D0 8K-(K\ 8K{.< 0Kw.T8K8 KPKP[\0@$L`XP0K@0Lp#D <P`P0K@0D#L4p P0K0@#4<$D,P0K0@#<4($LP`P0K@$4$@pP0K@$<@P`8K\0!@"8K 80 4@ !.0K <.PK0@ D0P L < 0 < D0 |8!!p@-(0`"dP  0". . @0   0 .0.   p8 0-0 1 0LPN  H 0@,00@0x%c -LM Y90 0R40 001#((8, "X#H`p $  H   %`V Xp  $8,  8 ,0S* x%c -4L@y-hG-@0 084 0<0   0 0 84 0M<0   R0 P ` p@  l0 P ` p08 40< 00 (0$ ,$  084 0<(00 ( 0$0 ,, 08 40<0 (0$ , 0 8 40<0  (0$ , Ѝ88R@- @0 08 40<00 ($0 ,4 08 40<80 (0$ ,< G-S5M1 ! 1! 0A1@QAPaQ`qapȁq $(,P !014 A"802<@ RBa?V V1 1 00q R Q{~?xQ" 2BRtb`rTH<0$ #2CbRrH<"02P pQq(%@'Q$brtlȠn0%p`T"c8qdH`p"01!P#2"&0'c*1a021eZ021` 0 (22@#,0n,0c̠0dLc<01`021&0l20p2'P#l2  #2\022,0220200(02 #2lȠ#2n@#0dHc8`02 &02l2b*0p2p2'#ap2P#2Ȃ` eZ02̂30#02 #l̠p(2Hn @#0 Ƞ0010H1 0X1 0h10x1010x10l1!0`1%0T1)0H1-0<1101500900=0 08!0(804!1 8(1 0 8( 001 !01 !01 !0t1 h! 0\1$ P!(0D1, ,!00 14 800< 0 !40!0401!1Č!x1Dl!`1TdT!H1t4!<1$0!1!$!0 $ 0 $ 0 $  !01 !01 !0|1 p!0d1# X!'0L1+ @!/0$13 !700; ?0 01  1   !1!1t!@h1\!P`P1D!p01,!0(1 !101 000 000 000!0<0!0<01!1 ̌|!p1Ld!X1\lL!@1|(!$1, !1!,!0 , 0 , 0 , 2H" L"1# #1" "1" "1" "1" "1" "1" "1" "2" "2t" x"2`" d" 2T" X"2<" @"20" 4"2$" (""3 " 0#3 20#22"#2 "!#@,P.` d"xBR AbX2aLR"p!0#P%"|rh\2PR@r4(3BRbp',  #<$L%\&l"Dr8,0@P`\2,̠r崂x.h"#<Ýl<02'|(",,Ġp儀ā|H PB.(DR#8b,r#Ġ2 !$L%\&l'|@X##8`T0@$P`R pr02 #402 #8|02%D#4t02%X#8p02'd#4h02'x#8d0|2#4\0|2#8X0h2#4P0h2#8L0\2#4D0\2#8@0P2#480P2#840D2#4,0D2#8(082#4 082#80,2#40,2#800 0  0 0 @ P`p  00|@@xPPt``ppplÝ " 20B@RPb `hp!pd"`#\%X&T'P ) L0*0H@+@DP-P@`.`

p ?|$h(\,P0D"4 8280,B<@@@A@pQ?U405ލU c r 00ā`V c40@  @0 -@Lph0( 0-H$HpP L@  d0\e 0-@(PL  0p0h6 0- @PL $((,0h $R0-@LP00@0 D s(,0 )0  /!( d1 `A K K   t0KK0@t0 p@ K0K | x @d@T`$0&HQ .=R"GK30a tKPK`t p A_K`|KPT`| x H! l8!4& @A @Pa tPK`P`C/K 8 |KI?KtP p` XQ\@T$XA t`l!&=E_K`| x KK`Q,pQ!Q_K` 3@` |K| x MKxS/K P` = 3OK@UKP`)W/K P` Y?KP`P`%=3@!t@D |?3 ?ST?3@ lP "} ??C?SJl0 $0Pp @(K -P8LP`p 0`R1!\ 0 0 Q< P8𨝘< `pl8W W80 0Q< 080@ pdW` -L(M8, P 0Q <0<0 0Q00L0 < H HP p$ .]%}'M$-100??#* ?S??s M$?3)m?0C ??C@PP?(@? 0p p 0@.040 0@ ,@ 0@P0 L@ 40K P0K%V0@<0 8@ W`@<0KP`4@'y0@tD0 @@ P@`D0Kp,p@H ,@  H040000 0$0000 00(0,000(KG-QDM@P8<04(, $t    0 "<4`p6( Ƀ.8080! " ()00 @`pp(p 0 ,(`$8*pǃp   "@@@!00# @$` p Z  DЍ - 0P# `$LP`pg# $ -LM , (0 @0`% &,0Ktt 0#@$0 @dd0d@d p%&,0K0#@$0@p  %0(0$Kemosuespmodnarodsetyarenegylbdet -(0p0 L@ c%(0'0P`0@% & `0!#@" $0P!,`"# -@L  -L@Tp(0P0(0 iT: ` $ eP@hT ` $@D XTPT  o$ -L0MH@K`pPT 0 ~K -L,M H D L0 `^@ LPH  R\ \PLKPG 0: S t0D 0 ?Sʭ L\HK ?ᐂ@,P/ ?p腂UL20 R02 0 P\W L#0S0 P W(KL @10P80 0: SsD0S0X0S<0 @0 , 0O,0p '0@0<0 ȟO < Y 8 4 qb @@,0O0 |"Xc8W`80< @0 L@@0 0t t0D 0 ? SʓHR0T R80HRN0< @ 0@@ 00 z @0 @0 0  o 10P3 僀60<  , 0 00  ŠYX -LM,  9/0P`,0S,@p,Q@T@a0 9/0p P`(K0S,p&@,0S@S0 9/0p@P` G-M$PP`l00h 0P01>0  0$5@ 0p RT001Tx?>   cp i  0S0X d @JTb001^ pQ?>   cpG C  0`0CW^ Bb   R 01Q 0110l1X100`1$ő\ 1 0R 02S\0 P3Ѝ 1 >0   r  R 10 01 -L$MH L  p ?0OO^P`1`>PL 0  BSLaeH L08`0?>   cpH 02ᠢ0!#PL0` p2RLH `08?>   c 02L!0#PP| 00`1ɯ D @ QL,0S PQH 08 bS180 1, !1!40 L00 0,<0 h1< PoQLL `0Oς  1>0PO>p@P` Q 804 \0 0S. 04  0 S ^,@ 0O QD  RH  0,|N- ?(KLH,0p S0QJ 0H 0 o,4-U Ec 889999 -L`MH5 Q`004 40 p(0 pǏx 8@x@d_ ?< 8 <@` 4!8@ a, QT.QT14 P/8 0 Q< 8  @ ?P  b. <@_@Pp@l h P8 Q <@(@`0 ,3R 2, P000 H0 00S8 0u p0OD0 @@  0k0PO`&,sD K tp p p D K `F,tKPN0P0O`$, ?~H00C0 1,RT0T!00C000 0<K(K0Pox0  0~ @Pd@ 0O ` . | ` \  < ?P L0 0OPK0@|| K X0 T@ 0O R  d\p 0O XpK,`P popP%0 00X  0 H , QQd\p0Od,`PPpK <0PU T -LM0 @00_Bd @PR 0 b4Q0 RPQB  K t@P  <H 0S 3SK| |U -L M p`,4 Sh|0 0 P, @ !HP0O0@|\1 aR\0?00S:@+ (1R\0?0: 0  00 T 0@5 ;0 @4D00L#40* 0 R0 ,~(K 0pc*=S \$+  B ?>0S @3CL#020C2 0+x%cU ,9L99~ -L@M\ 0pSPo0@0T8Z0LOPo P` 0OVʹ <4 S?}0 @ \40 P8 'HP0O R,6^<<@`0?0 0,0p@Z  <04@$ b $ 4 D0@4 DL# 0 0 0 R,P1^\0?0  0<0  B 0 ;0@0 4D00L#040 Q 00C00 ,z08 0 ZvyV1>0  ?>0 @0 3C004L#0000800 )''x%cU 99T9t9 -L0M L `LLH PPT P0 00S  L PD H^U #0O0@00S T08U ZO 04 R40 p F0SFp W^ T K Dv@ < 8 Z?z `0 , 0 K 1>0 108\` 2Rψ0O0K` 0@1 >00Sx 0@ <0 T Z p T K pRQ8 4 }Z8PK` 1ψR` 1> 0 #0P @` ^$  j$ 4 D0S@4 DH0L# 00j 040Z0C40  j! 400400L8@K0ADy@@ 0 0 R#A4w 0@ <0 S 0@ <0 @K(K80,@dYn \^ 1/X`0 0O0@1>0 AR!0 \ `! 400C40 i! 40040T0 RY3 1> 020$  B$ 4 D 0@4 D80L# 0 ^0C 0  0Rυ0O0` @1 >004x0@ d! 400C4000 c! 400C40x%cU -LM ,  @_ 0x8  0x4  ?n0 0wx`, p w@ ,84PP800\ UBQL4 CBABQ0 ,0ĘT@!UP4 V< ᰤx<0PQ`004vP`1`#Z ,vV`!@V`YL#20T 0U00 RH3 VHY@0SJL#20T 0U 00 RH3 Vr\AZ@0YL20 8PU@!@`02 08\W YPL20 80S@P2 08` BVPZ,(K004`v~ },P@T, ,L#2, \08`V04`V U TL#^08PU04`V  T  -LMP040 00 `@4pP @ 0$=$p(K  XO ,0P>* 00 ,0 v X= H#0S0C0h0 K P 4 (0 0pP+0d0Q5h@T'dp@l0S 0l0@l0S|l@l00S0l0 00 ,0 H#0S00 [_0 DP#0hp0 0$# U$le899$9H,999 M-L4M00T P S@0,0 00 S `3Qt 0a0S QARQ< D?@@c,d 0Pv0@0S@TmT0! ( ?Q< 80  \! 00,KTKyP@  p,P `u0,0  @(K  0F , r b4pǏL H0  01 P@  <K?v< K @ D@ @PJ  0HRh h ; d0,s c4rct SqQP l#SpTTP@@@  @ 4ß00n#  #@ x0S gr,L 00@<00, 0H,00Q0<4 Sʈ   RV<@D4@D_@0e,d v 40PS 008ŸD LQ4 0 j,<K 0 ?0Ueʰ0H@h  h Q d004@# c4! 0S#Q,x 4 d03t0,r,L 00<00, 0HJ,0@0\4KR 0J"#<@TD4_@0e, u 4S P004SP8@0 <0&""84@Suq=4 R:T@0c\D4K_ 4Sv:s9xe899 90L,99P99 M-LM@  0 00SN `0S `3Q 0a0S QARQ< D?@c,d t@0d PHu0@0S@TOT/ 00 , @P<4 S72  s nQ`p2ڰ0h  h (K#3 |P @ 0,"!@84`S  ?tSP 0K00L,e899 9 -LM P8%@  (=0l1 0 R P4 UR00 0a QUQY00 @P @ Pb@ 0b1re R1nQW@VY0:00YRڜpK4K 0P  04  B4 X`V  0  L@K0 @ @@ `00,KwP ,0H @4!\@_M R    00 @PvP O qL00P @ @b b3a R`Q R\H:D 0`( 0N@_00 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p/1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA` -LM8 d0 0"&1S0:S+0 0 (勉PP d0 d00 d0 ᛈP04KS0004@0\0`@,@Qp\p`80(KS-.clFc0c -LM 4 P80 1\ plWRl \R^Q V0 $400p004 00,K0 qnPP ,i(K,og80S4,85H 8 0  ,  00@@^3  pQP485@0L 0p U///// -LZ9\%t0R /0 RT0Rh0 S8 R40!R ,5s(5 ?0 #(5TcEcC-0 LS03Q% 5p00P5,5MS ڬ4S9Ӭ4հ4S@0Ӱ4Ѝ0t0O/ s  Q#`2C50N,O0@0PL HPP@`P`/0O0U4e8<%@5DEG-M\ 0Q. ` ?0$440O3C@$0O4D@(Pp0O/oǏɯ4 D 3C8<$=0 @TDdHtL 5\#ЍT-80\%R0$Ğ4 0Td 00  0l  /Q-/ p-L MP`U Kp@@h 0`PHD 0<P$Kphe9~i9D}i -LM4 8 40@hP0 L, B0,0 80h800 \/0 0\40 j Pod0p4 H4LDP`, l5. 0\#Q0Al @ H 8 R"j,0P0,0 800 \, R ,(Kd TS b5 @l4  `\h0^Q^,@@@l @044DPHh L5HsP5,5S4 0054E180S gi,P, SH 00Rx%c -LM\RQp`,0W *\%0R@  Kh0x (!WF@h0 00/_d , l1. @\$Q0$Kfl@P$( HP0S 3S gF@TU p-0P SL@`pPp ph -LPMD @ @@< TH0 b_㛔DP`U@5 0 1P0S00H X p0S0S 0S 00 L10S  3/P00700]h00600婕Y0SaP XD 0S" 0 zᒕ,PMD `R YIhT00S $0 td Q0h@9(9 -LHM` `X ` \  D d0\d0 P \P P P <GT05S*P(KDA X@0d0U 0T0  45 S: \XD 00K⁗PPDXd 4 0H \@ < 8 LP ; d0\ܟL 7Z 0jSXj Z\XRQݠVfT0,0X <H @aP T @PPO4^ITP0 0So ,`0t03U0Sd000X\} TX850 p0c Y !YP0 PHH` H H 0dH,K 0 0PPXd0X 0 R:0S*,`,0HP0  UT0@P 00@b b3a R`QdRpVUTT85@0L 0y,1^X @05D d0X 00 @d 1d 0S-X0@0 X @ Q`  0S 0S d0 0;0X Q U D0-X00X00\l L R0X@0S PX@ Q4 R d0X0P 0S P`d @<K40@X@0l@Q   l9L9 -L$M 8 @ dP 08 i06D 058 ` 00K& (@ @PH R U00@0lUA < 0҉PD  ;;SPt0at00S (0 00KPD 0 n <0\j p0\g 0d0 p\b rD H2@0P 04 0S*" 0 R0000000@0 @   <  0zPD 0S0D0  (0 00KPD @00 H 0Q;0 8ˊ060 8 sP 0D@ 60 Im@ 0H @0R =m@ }8  W@P060S 0hrD@ pxQ `d 0LQL ` t d ;;S dP D00bt0t0Fc,9xh<9 ///////-//// -LM0K@ P00 p-LM`0KP @P00d00 R r@F@pl 0R -$ L0S00Ue 0-L\PT @pP004  0 0 Dd0d Q  0S/ 000//E//00CS@,@,@,,,@,@,,,@,,,@,,@,,,,\,,@,H, 00/0( 000/0( ,00/ @00/ ;0/ 00/ L00/ 00// 00/ :0/ 1s s s /40@0Dl00l /0@0 0@0GcFc GcDl R0l0/ 0S00/0-D0@Qd0 0<@0@TP0 @$P @0/00 000! 001@Q@- 0@ 0$@/!00100000@Q 0 S /1 91/ -LMd@ 00PY ,0KpP  p(K,0 d`t0t 0p0pP  0 ,p p  pP000,1P*",0  0 ,0pPMOK { , 0ppP0 " p,00|e p 000, ,pt 屟P ԟP 0;0Gh.c p-L M `d@ P0dpcKp0d   嵑0d   ѐ -LMPp0d0CSBl0tS q$ 0`T0 D 0| Kp0S@t0@l`Pt0sx0s8HPt<`r:@ISt`00@`;00-@ #@: 00嫂 @0H@!0Rf D\S QX <1 T TL!R ,kfPH w@P*0  ,K _@PDm,d0PH1 M dL L\H LH 0RP0Ro 0,m 0` P,00P00SR0S \!P1R 0 0 P0\P!0@ 00D1 D! R T X! < 0 .R 0坃@HP 0RTQ H!4 R@H000  H!H0 00@P HH1  B 00C0H   P!L0S H 0 L1 0: S X!R@P1D 0#6 LHh@PX1S) <\HH1  B L00C0  B H000L1 0LL, Pd@ P@Pl 㗂j,l 㐂, j00 0 0< 0K _@PVl0^i dPP!d`Ui X1Sdl pV jU 0j=l 0 @ 0l  0Q L vL0S]B@]"l`p0Qo L1 p0Q@OaNOK P] 0o@P TQ@ H!00C0 H B H0 00.l ^jXQ T\ 0P;\,>'Wml=j -LMd@ R 0S`tP 0S ]K0S1S `0 ( $0``(KP(  000 0 ; -L8M0\( `6 \`3 (0S60pla@ K0@P`0 p)v`P.0[S "[0R4@0S T ([$0K3 (@`P (p V (P [$Kc(`=j..|99 -L8MDpKP` Q /P0lA,K 0 @`uP,0SP Q  R0.S R 0.S Q0@P`(K=j 0-L M0K@/0KPP0 0 L0S 0   t000K0`0 0#68#80C S 9-9-<9-x9-<9-l9-<9-`9-<9-T9-<9-H9-0000000000000000 -L Md@t0S 0KK/YP0 KKc/0KKP 000s000 -LMh 0d @`@ h@  ,0 \ 0@ dP0 d ƜX q`PT l ` )  @(0$  00CSh HPT T(K Q RQ  D < 0@(T\2 0Ap |@T | t X X@ B0O0 @ ? 0  K $A  2"8 @x0 0H 4 @0 x0S |@T'| x | x0S,P 8=,K/0PT  0, H<@@H T 00C P0 @ H S0@L0 p`B|8 R  L \d0 m 00\q 0Qq0 R0o<0S R0 0 00 0cSDS60@0 4 < R  0RA t 0 pR80080 @`P R\`'0I0 0c`0S> 0@ 00<@ D0 ;0T0 &<Q@qHH 0H@0 D0Q0< @00a40 P% 0 Pj/0|0tp/0OT |p0x@|@ 0,+p ,0H 0@0 0 000ȟ Yli 0,`S`^<@T00SX 0a0|0 Rm ` @00S V` 0S @ (000KPT lQ R\q06000h@00  h  H,P <0S 0Q0"' T | h0 H@T@ t,K/0wPT } jSuX$ /@P000 ,;T@ QV d 0oPT G0@tt0at00S @ (000KPT 10   d Q 0Q 0d0 Q X0T0 S h \q 00K& (@ @P;l0Sk Vi \ q@P060` 0XT@ d 0oPT 0ST  (0 00KPT 0 h@l0 S0;0\p060\ wqP0T@ 60@T7 0!R3 (0$ d 0>oPT < R) 4 @08@P0t X4;X0  x0 0l ;R00T0 \p0@6T@ 00l@hT0K K >  2"T@t0R0h 0dFc,99p989<9\999 -LWM  dR 0t p!  |!  @6t0C PT| |(KPK @elA l@00K P0 <@ L@ , @ aAx x0PK 0 nP| J@0lx!0c0R1 >*0pS0|1 x5]?KP`(@K`Q \a PDtQ pa X?*0S> F/ZKK0@h1 dA  0U!KU![KV1KU1[ 08#8(0K0 Q PoZK p]K xl!ʁ!0 @d 0 S:  0S* || @tQ pa |A -LQMh! hA 0`1 ZKL0Sd `070 hY1KVKht 0R 00d1 U@pIh_Ÿ 0P@ LP (@K⼐d`4 8KX dXK NK 8@ D` < H T` @` Fn(0@\",0YP (K 0#68#80C S񟗾K-K-H-K-H-K-H-K-H-K-H-|K-0O Po 0= 0@  @P000,K/00K;@P0`t0 0R@Ppd)0S@1 M?C(K(Kp @`Kd!,o0@P00xPU B ?Q,h!x /0@00S0@ 0`p@ 0d Ppt0S0G0E0C0A0?0=0;nPl 99 -L8ML LH H < d PX P% H0@T T+ T 8 Q L  0S 0SX0 0;0U8 Q4 R0000(K<X0 @0@PX Q } 46S| H < 00KqPP0X80 T P <\4 @ (~ Hnz, 6<H0aDX@@ f4 PR]D& 0Sc ,H:0t03U0SX000\ 6@00&D0 c4 n X !X@ @0 0ãL@ @0 0 ^UQDX ,K@;PPi`@0X@PLU0 XUPPWX0H yPPg<p'06Sx*P\,%:XP`%U% PQ,7T~X L<? LTK 40X80l@Q  *V6 P)X!P (999 -LM  d 0 00 0 0SiP@e , 0S2M  6S c8R SQQCQVS ,K p0<@T1$`(p,p <0cZ Q_ Ht0 ~@P,7,@ @0S 0@0PQl h Cڜ 64c cb SUaQUs8 4 0&p p0t  aZ!hP 0OTl@(KP@$0  S(0SP8K,@K0 0K p0 @;@ ,@P 7P(0$  000l SllPXK T@ 0SP0SV *0 ` \0  P0S 0 Hڜ@`P 6\5 c S\Q\PVP P FV|@ xP Ɯ@ @ D0Kd@ 1P ) P) P7 0XPKPYP`V{  @0pP@@0`YT0 @P0 @  37@T@ U @b3[DpQ T Q 5`?0S *T d" PTTd0 (ST9x99999,9X99 -LM\p,`@V(8 K00 , 8` 4 eLZ8P  5j 0 h0PP{i, 0S D0f0 PP(Ka- x%c99 0-0LS@Pd0 0 0S A RP  phP Q0D0S 0S -LM\2pd1#RSL0,S,  F" d0 T``PࠃPU 0 ! Pe\^U\^`P`6$0,&0 f"00i0a0b@ 0@ P `P`0@PU`P `0@$0(@P`4P8`,P0`5LS9 p-LP \bK@P 4 yi( 0g@hp -L`pP-\R@,0$S' 0ST 00 Qi,0Q g^P8zh z z$0 :$0\" /P303 < -LM 0 00Cb0,0 2ˠQ L 0E^ OƊ6F & V2((2F 6"0C,20$ z$68S2p,`K,08&H&1,2$6pS,P F6 T/# c1 S,Q0`7PP $68z086,2(Kd 1@064F`0@4&06!#/P1P064&L0S Y0 0C14 0 4 $< 8 4@00T4pK00  0 ,`t0 @ P  0O` ,S<K`R 04&Q 0< 80  -LMT0`R(@p JPP (KPP02 TP 0LPP$0000  0ePP(KP, ;q6PP$ T R00,P 1 h00 S0eVgY Kp0S t 00/ʚ; p-`LdP@ R  (phi;P  phb -LM 0P@  0`P  K;Ppd@ (:/y`P000J0@0 0,0 lA 0`@e`=j -@L0PSd` 0 0 pU JJd0  pP0! B!ALJ -LMdPd`V1LJp0!R BpT JJ P 0 0 0 p UpP10C1   V8qJ@10C1 0pF8 -L8M"dP0 Qp 0 ;;I,0KpP 8 CJ(K,0 d`0 0 0@,0  !@! !000pPN DK0 D0 0> K4K L0S `0=@K.0<0K8 d 62K 0C3K L0S `01K0@ 0 0. 00 K/ KlA ,D K0@#dpP (0d \ ,0Q!/YpP 0! B! 01000,I~000  DpP ,00q h=jp9 -`@0LSPapI( (0R aIpU  xbpP,d0!R! 00 }apU a !0 00 pP 0! B!H?^apYa  pP h -LhMP @, 0 ( (0pR` 9a,0T 9I,P 5I-aJ0J (K\ (0Rd0 0 Jd0   PX  aP08dh d t !Rv 00ot 0 j0: S\ X  J,d0P`0 dhd ! !h 000~PP U 0 aPd0S d@H`H\ Rh@ 0000aPh0! B!h 0H0S# `H,H>J00 -t-``  0, 80P` VP(Kf4   40 ,80 P;P   0 ,80`P %P  4800P, P p-Q M@L ` 0 @@P 0@@P 0@@P 0@@lPh 0 @@@@0*080 Kpi9i9Li9i9pi9@i8 -L$M$  h Q4 80 3:p  Wz3`g 0 PR 0b0h  @PS@g0U*Q> Q!1P! 0`P`TV!::@P  `0PU`0U @T (K@ R 0S@(0$ ,00V: R `0U@@0ST 0 % c P$( ,0  0R 1 S0!,K0KAP, 4V@:00V8 `80 p-L ^ B\0P 00Q0` a2@0c@P0 `20C@PpP 0@ 10 "  @$ B 00CS0 Pp - 0@Lb mP00 0R000 0 p-"fL@P  00b0fS0S 000  pdb99 -LM@, , 0S,0 YJ @IPB @ 0P`VX 0$@ 0P`VN 0*0S((0@3cpP-  0@qB@P# =0 0C0p0  !( A( !ZDAZ PY(KM`K0  !( ( ! 0Co @it9l989 -`PV,LQ00C2SΠ BP  R00C2S QT  R00C2SQT \pX pt,`dV`P W 0S0$p(00(0@`p$00 $ꐅi -PL!FTp/ 0`P/".00Wb A0P P 0 0A0 R 0 10  0Q OM999 -L !Q 0hV;9 -L!0C0S(pP𯝨  !W/".00`b@fPU@a0 P'0P !1W9 -L !FT  0 P/".000b10 9 0-PL0@s0S Q @hHTb jH0h=b j0S@00h.ꐅiii -LM vZP(K0#2  2Z0 #YW@``0PU W00  p r7 0H$0 ( ,`"Z00 0b kPF Z X0 p,p  @pHW `  P3  (0@0(00`0$ T $ R00 P,0S`X``0F XW@h000Pb i Q @Tq꼄iiii -0@SL ,PU00$00R00C2Sl  0 pS Ho(00C(0U 0,S 0C2SV P 00ꐅi 0-( !FTL" 0P /".00 b 0S 020   00C 0 R0 0h D9d99 -LM00 Sp,c0Q00 Z BB"R,C2S, ,0a( 0S7Q`10 PU( , Q00C2SV@ PT , Q00C2SV0@00XZ00 0SIPT,0`S(K @T@U  0P0XZ00 r0S'00 (Koe p-0L`p R000  R PPU @#P @10P  R 0A$0BS0aPP0 00ph"9 -<1`L0V0Z0Sp1 0S PPU @P @10 RW 0A$0SW0B$P @1PU0@S `0V0Z0S 0000P000S@w`ꌅi -L M@ 00P@p`PP  0@, 0@U p`L 0DP@,$Kh9ie`i99i -LpQ$M@H L `D@ Չ1P< P0 S@CWeQ0 0a00P 00< 00@WTa 0S0C0@0 DP @0 DP T\LPpWAD!1P 08 0P 4 ,0 @W1 0 SQPC0WdP00 `00R4P004 8000 P 'JD 0S U0000PRH @8W(K@Q Q,00,0000DP 0@0 99 -L@L\p`P \  RU0S  0Bs𨝈U  0h<0 00RUhb 0h+ -P0L000S@p` 0Cs𨝈  0h 0h 0S0 -L M4 @@Tp@ 0S 4$0 0bQ#6,0 ӷ, 0#22Y#b,0@SPpW , Q00    0F$0 ( ,P1b `gP Y 4@0 0S ,QD4<0 ! 00 @`aT,`d`h 0Q`j0  0P#   0PP V1!0 Q 0$ 000  ^@,  R000C0S0j 0 00CsZ44 D00D040 < @p0S0 00p(KVfPP0E V,0Sa,2  @ #pZ,0SC4D00D0Vp @, FT P  PP  (0@0(00P0$ T $0$Q TY P404$ 00 c"&<0000 P$`0e#6S\  "(<0U#8X8:X2U9:4 P 40<0e 4 PD0@0D0P(Kob f Q @T(Ko40D  D 00C0(Ko440 P "4$` 4#4  P$` 꼄iiii -@LPT00 p-PL J `P@T`0  !( ( !$Tb;Tp@i -LIP 0 `i -@L:h)`i 0-@LTP (0 0  !(  ( !0DT<4hT(0h0S p00Cp0@i`iЕi 0-`P M@LT 0 P@(0 QAK0h`i49Еi 0s0 0/ p-0AL01 @_P ` 0S P 0S 0SpPRpP P 0S00@ P`p 0Sp*0i<9(8 M-L M@00< D @  <0@S[D 0" 0@@ H0 SB2D4 00 H8 <@80 aV5  Y, ,t 0S(s X] 4P` pQ10@P0PSS 0 B0 U@0S R0L00 <,`V8HP8 Z!p00jp0(KOW0`pD0OWVD Q<@0PS0OWPVZp p00jp0YD 4P0@Tp VX4@R0iЕi p-0LP@ R,`p0@S0a!p R P 010U`P V000V000C0S R000  v;0iX9t9 - L@P S M-LM0 0`0 , R 0pO# @  Z (KY 5p PP (0 @ 00CS--<-<--- 0SE0@TLR6v90R(0 , !( (, ! 0CS*0pW0p O &#*0@Z0pKpڄ0O#Y0Q !hR:nR@i999 -`ȟMLVF &(*0&Z S0  pS(K - 0Ls`0CS 0RR R$0$0$0 7RHR@T (: 0  !!( 0 (  !! Rt!0ɑd,R@TLR @R&R00R @P R !p00Cp0 0Rc bik !G:0XpQU @T 10@P QL Tp00Cp0@4iTPpWHc@i9Еii0im 0-L MxPU K0@@\ 0TTP<88( 0PK0h(e90i9i -A2LMpc S1 # $0K-P   $0R`0@P@RP0S  70 000! 0 @RPc Vb -LM0@C2A P # S<#Sp c 0K`P  L2 S<#S PQ R000 R0QL2  S<#SPc b 0`0p -LM A B2 \̠# S<# S@p< c 0K⤆`P   L2 S<#S PQ R000 R0QL2  S<#SPc a 0`0pYp p-`L@c 0obPP p0S 0  0Sc a`Pp@Q0@S> p-PL@c 0Eb`P p U0 P c paP`p -`LPc 0!bpP  V@ $01 P0 0S1000C0SH\000@Tc 6a`p0i@Q0@Sھ -LP F& 0S\1 p`@U    0@S/D P #c0ⳅP@=  0@00`+ 0S5p0`0  0O @R 0$0 p$O0c aP@ dqTy`p`@0,($Hc,etHcHcHci9$9P99 -L M@ YpP` D < 0  !( ( !D  D @ Xp :@P`0s  52@P (0 X  0 X<0 p<D\@ @(K0 0%@S8 '08 P  06@P 0  !( A( !.!( &(  ! P 8 0100@0Y`p4 4  R4 :@`p@T4 0R  & G&0 , T 1PP (0"0  !!( 0 (  !!@TP 1PP0 PK6PP?@0 , !( (, !0!o@0  !( ( !@T0 00@S@ ;0@Q40  !( @( !Pt T@P @ ;!N(0 N0  !( ( !LN6<lN  3P @01099@i -`/ML&@!*$Kp 0K @ $p @ @@PP P  LN 0 , !( I(, ! Zc9 -LM 0@S  0Sx/Md/`0 R000   , M h^0C 0΋Hc9 - LàML pWP`P1W 1W V0S0:S0 :@P`  07/ptatLPUPU 0S06 00(/$1SL  ]PL R  R 0SL ] ,000S0 00pPL00TL 0H0 0L000$uLA0Zc%%HcHc9Hc 0 0 0C 0 /Te$0@/0l$0P/=j 0-@PL0TP0 00   40R  00000Еi 0-PPL@0T   0h  0hu -0 0 @ 80LRP`5:<0Rp2:0 8@P$ 0$  c R 5D0 0@ @ 80R:<0R*V  \ @P 400 -LM@Pp`K K P1 U@1$PK2%* MP $0T: $0ST0S t$0#&R :0R*0a 20 2JW KKk@iHj9 p-`@LP   ph -bLM0p00 R22ll    P  .(0!g 0  !( ( ! 0 t@"0@TG U 0 <abPN000@T 0@2P5  0 M0 00MQ(0@0 !( C (  !( , #Y-m$K\1JT(K0 000; 0 UQT000,00kJ00XJ%3HJT  , 0  0Еi=j09@i<9 -LMϟ! @|? \ : P L H0 PKxP^ 00>0Sp1x# Z00 W0~Sp8  Wz3X@3 8 ,0K @AP 0d,S0!D <0 6z` / ,4PK@ 04@ 0P @ Z<0cX@ (KHc>00   -L$M DL 40KT4 p00 < 0SO h"h2QP8 \< \9 `,K8< 80,  000P!4@,`T 4 ,:,0 @T 0\ 4l,:,0 @T`u4K;'(K@AC0S ((1@ &0S 0S~C4K '0C! S, 0 0 l0Q @ T00 2|aC 0 S ` `R`^<0,  04K `&P_ ##9Ajii:=j -LPp눀`10t@?C 0R 10 P !C|+C*r+Hci p-PLMPp)@`Kl P X0#&R*D'0R*0a 20 L+JUpAjHj9 -LPM($rB 0R Zl 2   B PqB 0R1   B1ZhK@ @@ h`K|!p8*0 @P@0pP`8A1XBP1 Q 0 hK!PR U[BZ SBU1h K@U@PQ 0*+1(K0@p  T0 00 @` P@[BVꜗi##Hci9 0ZR|-j9 -̡LM 41W ,802 0cP`0  !!( 0 (  !!04 L:P@zG`W 0p (@Pp0x Ll1pS 1W00S,(K, `q,,  a(i#Hc=j9 -LMp@ `.` $PK @ 0$@ P @v \K -P`pWL𭝘 #@P+ (0 0  !!( 0 (  !!0 q0@P`:P@`XW% D@ )4@%  Pp00Cp09@iЕi -LM>0`~0^p@0P 0` `P @kP 000+T 0 00 0BP  K0 @P匸劸券##H99t9 p-LMP@ |`|0 p0  `0R0 P b 0K@P0 P 0`KpWe(iAj#Hc9 -.L M  8 80(Ǩ0!Y# 0@P(0 P0 ,(KZ1P ,08`0ap`p |1ph  a(RP4K@  0 4@ |#PA,P0U984 (,0Z0S. :@`p4@ R00000  0  0 &0  !( ( !Z0C 4c,0Z0S$n,8 IHcЕiAj -L M0`SpP5 0S@0SQ4KP40 0 #*@,K` P L,!&R*8吷0R*0`#2 0 00  000 JU K$ "0 0S(K0 ~@J? 0`S00+? } ,$0 0S AjHj9i 0Q-L@00S 3/D00D0p@-0\ @!@1Qp\ 1 !R`#`3P TQ030 "SaP^ Q0#02SQ#3T0#0 2S%pP/ 0 S(0$ ,00\/1P/ -L`$@0@PS:b V@cp V:E. f@U>0e S 0SR F@U0P@0F\2 lU" R!0e S9A U R0ST0l0U 0SS1:Q0P@U 00b S9R R0e SYD0S0e SI9@0S,  `0R 1P `0R 1/ -@PL`0P`@T 0Q-L@ 00S 3/D00D0h0@-D0DQ 0$@ 0TT0ST0SH H0RL L0RP P0RX X0R 0 00R 040c@P4@PP80S@Q 0S@ R00S0 0-L@PP D0 0U:$0U#300< h00h0/ Q-&:$0@2 PP 0Q:0Q4@0Q*H0Q:L0Q:TP 0 R 0Q:0Q4^D0Q*dP0Q:0Q4 0 Q:j$0(0@-P Q0#03 P$ 0S @@1 Q#3PQPQ 0T # 3P R0T # 3S RdQ T0#03P0S T0#03R0STQ 0T # 3P R0T # 3S R\H0LT # 3P R0T#3S@P T # 3 Q DRT0#03\0S 0j-$ (,@0 R:D0\34H0R:L0\34 -LpPU/ 0S,`@T1 T R& @TP @0 Q 0` 0S0@  0S@@@`vP rPU 0 00p 0 0  R P< X? P@0T 0` @Q0S0P  0SPPP`CP ?0SP080S0p  0SppP@*P &0Pp0p 0 0 y0S@00S0p  0TppPP @p -Lp` R 0SPU 0SZ0 0`R 0S0S @TP R0 0@ T`@0S0P  0SPP`PP @@ PRk Q 0S R 0S 0R 00  S`00S0@  0S@@@`:R 0S0Q 0@ 0S0P  0SPPP@vP r@ 0R 00  S`0d0S0@  0S@@@`VP R R0 00 0@ T`@C0S0P  0SPP`P5P 1@v R 0S|0P 0@ P0S0P  0SPPP@P @ \ -pLWP8 @TD@0Sp`W`V p 0Spp U`P@ 0U@@ 0R@@V @@TX  p`W `Vp 0Spp` 0-PLP@! #3Q0 R  0 S R0P 0 Q@@00 0@0P/  S/P 0S0#03 P/ P 0S/0S/P/0S/P/0S / 0-8LP@P'< Q00R03SQ PD0$ T(0, 00\ H00SP 0T00 -LMP`p7*$0@0 @0T,0 9 P (0$ ,00V'@@P` $ 0S X:W WP P0P d0P wV@P0 V,F7P @/P@j P 0S/0S/P/0S/P/0S /P/Q00S/Q00S/ -@8L P< 3T 0-(P@L9$00$00h9 p-(@`L9$P0$09p$phxx$0HL 9 -$0L@=LhL$0/K$0K 9$0L 9 M-LM4 040` P @xh 10 Sp!z3S0CD  , , K00K0 PPFY`+,PU (0$ 0TI*,Q $ (0g @0RDT:H0RLT*P* 0@P@T :,P,  ` y(K0g00T0@ , K00K0 PP  a40`@y z_, ,P `<0T* , @j p-LM$0P (@`8!JP 8$0 0$0$ X0qy8$0 J 840040p840040p88 -$0LP@ 8PU40040(`8$0 8p8AJPpP3U 8$08JP -QL M< @0 8 80Q:<0R0,0 ,(K 8<@P^ 0ZD0Q F 0ZD0G>$Z(0, 00Q5P 0Z<,  D0@4 0040 00 ^ @  $0<`Z p1p!Q`!V<J bX@P& PU# @ 00CS"+.+. +. +.(+.+.8 n0,0  8g , , 8 ^0@TP jW P*4 0S00S a500CS0b$0 Z p1p!00S @ L0 D0<pbP0b 0b04P`@p0@ 0A,P, P Zq$0Z p1p!$7'g79@i -L@`T0000ůЭ 9 -L`PP@ qT p  fU $0R P@T,(0, 00,000  0@@ -L@p`P < 4$0( ,$0( , 00  0@ -L`@p*PP  P|PP @0S @0S P  0P@ 0P@ 0-L M 0@RPP x0SPK0$0( ,0 0 $ (,@ @Э$9X9 0- X0PRRUL*0e/s B@T2>000B -\0L@  HhD<h@4600d T1d@0CT1h6djjg(iЕi -@LP R0000 0 P 0-L Mn6 0d0 d0d 0d R@ 0P @忧屧| 0td @崧`㦧X 0Pd@婧8囧(㗢K0hg(ie9j9j9dj -Z%ZULp`e    < @$$0X+*@0(PS$@d,P  << D05 0P0 04 48 ,0S      o(P$$ bP!  b `h0@,408@0 dPtu00LeT$0 0-$0L1PU Q*4d@T d@T1 0T1d 40\0T000000 P 婡@P \P 0P d0 0dQd dd/yP XHP匡@P0\08Oc(igЕiЭHcjT8`88 gHcd9dj89 -LMPQ`p,P  L, V3 $0@U@2 $(0, 00Q[ TO ,0S(0 S$ :(0` 2, R00S $0@ 1 V ,000f,0 `YU , YT , QN@ P f0,408@@ `$`( 0 D L H P T X < a,  0Q 0f S:j(0(0j 0-LM@P\P0 $ ,0PhP0 -L@P` @PD`HpLm -L M@0@`Pp!p1PP1P!\„  0`KD0 SH0SL0S -PL@pᤀZ$08 0JS`!`1PAP ,0T$0( < R 11S63bS<Uij -LM<08  0-L*"*R@P 00400P0T0X0\0`0d00 0D0@0L0H0<8`$PtD 2(2@<0`00 000 009@i -L`p hPC` 0@ -@QLP`p @0S@0A0 0h0$@ -LMp ,@P 0`0 Kj -L MPpU0@`0 U (0$ ,0 0S *PP / $(000 ,,  m  00\ 0@0 U  0 , 0 0 -(K $ X00R0S@ -LP`op 1< @  ֝  0i p-PL`@ 0ph S-LpQ80< Q`!`1\ P1P!V: @P $0V* 0V  0  X@P 0U$0U* S-LpQ80< Q`!`1\ P1P!V: g$0@V$* 0VTP@P 0U $0U* xP@P  E@ -LM<P\@`p:\:80Q:R*@  K?P@   0T$0V :Q 0S @ h /   $0S00S@0SD0 0D0 @0p  48 00 0 -. ^NP@LMU`P@O 80U@3K:<0TG0P $pU@*D0=P 0T C 0TAD0;$T,0( 00S1 P$0T'Z, T0S 0UHT0S $0T<: 0@e@@$K@  t@ cT0S 0U T0S $0T : 0@ } x O J -QLM`p 80< Q!1\ P1P!Z#:  & B$0@ZtT~ 0U gP U$0R D0aL00Sd1 W0S 0U Y10SX Z:U?:0SH   L`H H`R D0T0ST0 $ 0$0 T 00V00S4@P) U&$R D00HSX Z $U* @  gL0S $ 0P Hc9 -L M`<8 Rp1 p!Q@!@1T00 :(K$0PS  Y RO 0TO0U,0 : 0W7y3'D0 0S,P  $0@ 00S$ D0$0  0a c , K00X 0PW $ R 00S W* WD0 $ @ @`@kP  -LM<0 $`8 ( 4 ,0\p 00 ^ <0P 0,0 @0408@ DPTP]T1X0 R c8K 0T X0  80K@@T8K h 0 S嫠wl 800c`pTD00D0T X0 @g 8 K3L@ @jHcj9 -L8MPp%<  Y`D ,8 K@4 8@ P@ " # I@0@ ,@ ' , K00KP  8K@\ @k(K ZP @0@ ,@ \ !Q X 0H , K00KPYD0< X3N@[ PQX , K00K @P0 s*H 8K@,0 P @P  48 H%2<0P0D0LH  0%D0T X0 4 D 0D0 0D0 < "@0 00@ 0@0 v 80Ka8K s,K0 K0@ eP\ P/ S/P 0S0#03P/ -L0 @ᾔ1P  1S/000P $0 )0S"02 000P0,0 0l   `  l0000  c 0(0 $ 0l R010201 gЕiHc p-L8M` 0PP. Q)0@ S'o.o.o.o.|o.p.,p.p.o. q.(q.8BK`00, _P\0X 0 0_S{\y! 4?2cT0`Kp-L@Kt0 0<^ 14^O? ,^VϠ @1$^< 0u^AKX00, 6_P\0` 00_S2\0 4?2cL0X@K\00, _PX0` 00_S\X 4?2cP0\D 06^ :0^ЕiQ4j$cHc -LMt 0P \1\ l/Q𨝙,e K 㯓01\ @@ )00CS,r.r.r.@r.@r.@r.r. 1S l0S|0T R |0S@ @ \ ePp0 #50a,#50 ^T T2! \ 0&!#5\0 @ `x%cHcg g\4jD8=j -LHM`V1P1 @1 \H  R00 R0Sx!0RL S@E T `(K!0x1|A@E T\K  K`PU U\ XR P0@ 0 psQP TW00S@B R R0@0 P .|Pp `|! 0RQ40KW, 4 00 S1 d h0  ,0K*`P1`0 ,0! `P'd0W0! 0`0 d00d0 `0nh0`V ,0h` S P i,@*40K ,@ ,0S `@ S,*P40K  4KR40K,` 4` 00 Hc -SLMp`P@ .$0@ 0 H&&R  @ w R 4 60R: 0!@P  Еi -L(M@8  0 4 <0 p `@ t 40:#:S@91 8,0 0SC 3/ PU ƠW Z, ',  ,0< 8,0 Z00Č,0048 0 @P@048 <0(Koo0(K/< P0 /T08  0PPʠ<  T0Z8p  0rP0S@ @0, >0>00 -LMp@P` # 0:#:S 0   Ć Ć780 P 0i80 R>0>001010!# -LM ʠ,ʠ\ 0R lR >0. R 0^  0+P  0-LM@ʠ,ʠ\ 0^* @l^ >0^ 0T.Ơ0 H R P 04d 6R0  0P 00`0S*#0Еi -L -LQ 0 0 0` P00 P00S#@-@ʠ,ʠ\  0R lR >0. R 0^ T\}.\}.\}.t}.|}.<}.D}.  0@  0@  0@-0 " 0S  ʠS,ʠ\ 0R lR >0. R 0Q  0 0@-@ʠ,ʠ\  0R lR >0. R 0^  0@ -LM@`0SpP  K0S(40(0S0J@ Q(,!: 1 R (@K D0 (0 NT[$0  D0 CP*"*R 0UPbU >0^PU 0Q  0RC/,0 嵚Dj8:: -LM@ ʠ,ʠ\ 0R @lR >0. R 0T`V0TK p  0P $PK0@ $@ P @  -L,MH T H P :#:S0D >0 Z< *2 P08 40 ^8 03P L 4 T TD8 0P4 H4 PP , KYPr ,P. 0< R*L|0,<$ QSa 0R^:D0<Y!0000 ) 0 0 0 R# Y0 Y0,ZP,  0<Q PFH T8 dLD8 ޾L8 24(K@ Y@  Y@ 0R0 , < aP 0S0000S 0S,00 @4` @dP nP00 PH T8 # 040 4  -LM`@00 SpP (K 00Q, KPP00@0S 0 0K PP000, R 00CS 0,o0,0 00@SP *10 -LMP,  `  0S  @(K0S h Y0 S0 >  S X A@P!Q  0X0@`Vp >0X  , 0 c:#:S, 0R0S4R 4 q   01 0R S 06@T 001 `,K0 @ T,0 000S   B0R  yP @  0 S  @ 00 QQU Q R|Qz 0     Q M 0 @ 40(0S=0J@ Q(,! 2 R 8@K ܍ 0 80 L +R[@0RC/DŸ,0 8tQq @!Su @QL QT0 PO $0  D0   `p 0001 `,K0O@TQ0 01 0R? S 06@TS @ B  $0@0@WUVS@0 0 CR  K(! 0@PX X00S     0@ Q ?DjD::0 00/0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R000000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R0 R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S/0S/P/0S/P/ 0S / P 0S/ 0S/P/ 0S/P/0S /P/Q0 0S/Q0 0S/0- @0 S0/ UTR p-@LTP `P`@ @T@p 0-@LPT P@ @T0 p-@LT`P@P  R0T 0@ PP P@p0@0@ @P/ -@LPP`p 0  !( ( !00C0, 0 0, U,0 `$p0,0P0  !( ( !000 -LPM< 8 \Kw Kp@-d0 P0U#F"``@ 0T !P01Rb`0^pIcHj0@-0 @@$!( (P@@$!0@w - rL\R20 RP@L0R P U3 @0Q  Q*60 0 0R0 4 R0B60  B0CR0 \4 `LV`@DPV 0 SAP!@P@ 0R:P Uݔ\ `LV`@DPVʹ|ʔ60 0 R \ `LU`@DPVIc(iHjL:x: -LhP \0*0  0P 0@ 0P 勔Еi: -LM0  4 0  P, 80 < @  (2(b$ȟ. 0PQ<0 @_TO T"vMZ(00\Ql!L0R A0R @0 Ul!L0R 0R d (0 0R0HA :#:S 8 f40Z C$1P*VR, 4B  ,F@w<00@ 8!"&0@(Ko 0@ ?SʭRD0@0@T P0U ?@P 0QʙP(KS,hЕihpi=j(iTh:: -LMP`4 Vp@q V,0S  0SQ21C  4000(K 4 Ph#2000 0P; U, X `FJ$&0RL04@<0@0D0H0: R*YG 0  !( ( !0`VPY' 021C, P B 4,  垒4 (Ko蘒|喒4 0@Pd0荒X(Ko艒h3,0 g CIcHjHc:::P::: -LM,a0PS  A* pW$ >0n`0gV@P0U,>0 N@ U $`KP% $J Uhh@0>0>0 0KU IcggjAj4:`:: -递L@M0 , 0 \ 0 @@$5^ p 0 0b\0!6u"3@u `և0SEڸ 0PcW@"#::2#0PFU`` ƠPʌ0L04<0@0D0H0 R 0S ! 00 0^ n3  b0S 0pePcUgc 0, >0>00 00 >00!` 0 P00C 0 (0 0, `\0TXL(K(=(iIc`jB}HjЕi:gig:@-0 .!( (@.!@@-00S%(00A R0 10  0  !( ( !@00C0(0 00 000000 R 000 0 !( ((  !  B R 0  0 Еi(i-(0 C RH 000 0  !( ( !00C000S(00  !( ( !00000  0 R00P00 0< R0 0 0 0 Еi(i 0-(0LP R0 <10  0  !( ( !00C0(00&,0   PP@0!!( 0(( !! 000f(00@000!!( 0 ( !!00  P P(iЕi-000CS00h00`0 000 !(07(0 ! 00C 0(iЕi -L@\ $0 0  !( ( !QA 0  !( ( !A000A -L$MPŸL`D@0@VPU8 4 <0 /<0@PPOTFt 1@ ?S,) Z 0s ,0\(0\ʘ1!lL0QHP`0@K  0 @0 ,@ PP @(KR1D0Q Po0RO 0@VUV0@< 8 K VV 0  !( ( !h0 Q0  !( ( !S,hЕih=j(ipiTh -LM`@.p,PK 0P(P  ,@ @vPP(,^% @ 0 0  !( H( ! R000(0  0  0 ,@^$KOc -(L@L7 R 010  0Ǡ   B ( - RN 000Ȍ 4!00C000S  0 00C 0 R000  !0(000(000#!h R 0 0  !( ( !00C0, ( 00,  0 Еi(iyp -QLP`pW5 0(0&r`VP @0Ds(0 0  !( ( !`VPU(0 !0  !( ( !Q@i -L M0@KS8 0 ,@ G ΃,Ơ0@ cP4 50@T2 6P` P `8 e000p0  !( H( ! R000,0  0 q 080@T4(K孎: 0-L0LP@L|00 0X El0 $0lE@l:U0hhT.i -p0LSP`(0! R& @0!!( 0c ( !!0,`SP' \ \ X4 (0 U!(0 R0  !( ( !`0PSw0 !( 0 (  !0(0  0  !  -LMpP@` 0 \   00 0 0p?0$S 0Q?4dtmh*dp P`4 40 @#FDV@18@ "3 `V@@P:LiЕiii -@1LMl!$pK(0 $aT1$ p   1AP\$@T0  @PP $@T 0  !( ( !@TP$0S 0 >$0S$00$0AP=jЕiLii$:0 \ PDP @4SQ/D$DRH4H4H40D$H4 d  Bd / \/`jЕiT0\ P ($R,40Q/DP \/`j -L@P$40$4 -X0L\T0 @ST0 00\ @=T`j p-$L`\P3 0R @'0S# @T 0  Q0P" 0@S 0  0 00PD4-H0t ` d00d0p U\ 00 0 S 0  0@0`jЕi pp-L`Ppk(@a0 0cP 4$0e 4l  el p8wЕi,: -LM`d0pSOL`VM PUDTU 0 4$0S0 @0,K@ @TeP DTU `VZQ!00D$RH4H4H40D$H4 D$0-H4 P 40 4l0  l (,0(KЕi`j0yLm8 0-L@0T4P$SE^P T40T40   H00H0T$P4R P0000 -P@L,<80< 0a c< 00C 0@0S00S [n0S 00;00 @ 0 0S T40CT4i@<0S0nhjj p-h0ML` @P0 K@ @dP0,d(4Kpwdj`: -L,MH D d@lL LH 080  DQH H0<@0 0Oᄤᣫე< ~D LD  ?0 PD#<0eX\lH0p0 ,To@ 80K0 P,2"@`\tPx`|0 84@H\ H< 800b ccQ3R 3Xሀ H0 R  H<800` ccQ3R 3X᐀ L0 0 KRLP0SWLL  00, 0D0ED{<\< " @0O@ D L$@D? 0 8K 0K,0K>@P!80si40sfRvPL0 0R0  \RH00@ ;00LmH<(KPL@mjhj` /!Ce /p: -tx 4DK#6:Lp@rP$ (4@$0cOF#J6T[Qd@ Q v@Pu0Ot0x@iL i00 ;@ 00@i: 0-0($@,0LP0P 0000(,ĥP $$4R@0S" 0@ P 0(! x$h00bh0@P 'P0(,$0Ga0c\, p0b@ugЕidj: -L"LM@d0Vp@ (!0PP0SQ S P!0V 0(!(K$40"!B 0S 3/p@ @0OD K4#R0 A0  ZP@QCN@ 0p $!;t\0@ Ipp@hc00S&  0bP ,uK(!0PP(0 (|KPP(0E0 0P44;L$@m 04 000h0P0h0gLPcIc::Еi -d1LhMPu  KP K%SPA %88#Č@ {pKa@0, [ @s\ \`  00@Pjj\  $Ij 0@4 Kt0lP  &@E$\u \( q {pK[ 0s괧c:=j: -GMLMP$ `0S? S jpP> |(Kl3Y ) `PU DTU X 4OF#J64; 0#(pPAnD+0`cpPDTU Y4p2pd 4 lpPKHH+,0K-pP+0@KRcD 0`>pP0t0CS ///////p 0ST0! p\ P @ 0PV  r &Pp 0Dp pP\  \@  00@0PST00 000S( ^,\  , Mi(pP  10Sw$\} \@ y p\ p pIc`jЕic p-PL`,xU@@TphZ@i -LMp`d0@,P@fKTK0$@K0@ $ @ `PV@$0  !( ( !@ R000 0  T LiЕiOc -70#L0`M*x0 000p  t ^P| > W0p$40 S%:S 0 40 S:SQxP tQ! h`P$U |lK_@ lK ltQ  PS|@(K@3#lL0Q x0S\#t0  0OF*p#J 6|Y0 3 # ĠP,0 xHt\PP}삟P@)6Q8040 t0SW 2"lL02\@0"000| @ Pp |[ @0PJ H00H0x0S0 Pq |Pp@`*Lf0  !( ( !`VZJ|)(0Kp# pP| G00x;@@\00 8|YpW& PZZ Y *f|0PS '0S P zXi,Y p|lKq|Y Oc4h=j(ig!CeLg@ . -Ll@Mt0q0 t0 pH09LK pP00P00Sp00p0Еi00  -L M0 S0d% @\0!@@@_0P  0@j|jt 0l@jXjKhD0P 0q,qLg`jЕi<:djh:jp:hjnc :D:0@- 0S0 06BQ0(0 a0"400@_#& U0 0T0 -LM0 p>0n`Q70 a0@P$0S, |060>0. V  b 0 K@P0 P  ahp K f 0| 0f#&B| 0S* 0| 0c#&|  : P-0L R.  . h q: 00 0/ -L4M0\ P `X Zj @<0t"0h8 0S_ R@@ \P  Z00ST K0R00n\0T0@0@T0 B? @ġ0 l< L  @00KP0 H` Dp ,@ 8 @@ 4 G 0SV (1@ XPKI`0@H V @ T00T00S` T\[0 0C0 S V(K S@f X00R0S T0 `e0S7 X`Pl \T Xl&(1XPK `:=j -LM= - 0LS0S\3pxpD0 0@`,PXW𩝘: M-LM 0  X0 0HW@`  | 0 x t0 0 |Pt Uzx0KpP` tP 0  !!( 0 (  !!:@p Q P`|@Tp 0`,0 PP x`K  IP" m ( m 3 @0 P0!!( 0 ( !!(  @Y 0Qy :`@|p\m xc R 0S P0000@%70S0 =0(KU`p00 @`P@00 |@ T0K0@x0 t@ 0P |` _,0 =|t Q x# (  0 S0@0  # 0  !( ( !0#63@`pQ]jeG{0!!( 0 ( !!S 0 S , K00KpPK 0 ,P x@K00@K0 @P@T 0!!( 0 ( P!!T 0^< ,0TQ. (0m0  !( ( !.!(  (  !O    0Q0 0PP^P ,0TQ0 S  0T01 T<޻00  !( ( ! ɻ( Ż0: 0,0 VA@@ m@Tj50᡻4\j mm00  p0!!( 0 ( !!90x@Spx Q=@ip:::<: -LM`0p @0U ` p KT0  0-LM@0/ 00H00 0 P0S P0000| r50S 0 Sj00    $Q(0(0(000 K0K0hv4m|:: p-LM 0@C^ :`0000P5  0   0 S 0 " P0  0 #50S    $ R(0(0(0  0 0KphKp0 hKph4|: p-LMP8414a@0TH>(0S $@T U0 0S3 0 0 R,0, 0@$@T@Tz,@T 01 P& 0S0  $Q(0(0( 0<0^,@TKph 08jHj@j -P` LpW 0 S s 00@0 0l7l! =j -LMp 00@"0p40S{  0SQ 0 0 0  0S$0 $0(0p0(<0@600 R; 1lK 0(!6P"PK`| 000P `@P0 @0S$0 $0(0p0(<0  A30 0@0$K53 0T0 l 40  L, K0 P(0P0, @(`0 @Qd&T 8 0#40"!B 0S@v:Hj=j IcLPchd0 Hj8j: -L M@R \IpP` 0 0!!( 0 ( !!0\p:@P`0s ^,  (0  X 0p\0 0RP P(K0 0P0\`p \:@`pPUY  U `P, + (00  !!( 0 (  !!PU 00 , !( (, !0(!(3P0 P^, ?PPU ,K 0PPP,0 , !( @(, !Ᾰ,00 ,(0 2,0  !( ( !H, 1Y::@iQ00R0 S-LP P00S00S000P4k:Q00R0 S-LP00P00S00k: p-`PL@ P^00P30@p p-`PL@ P^00P30,@p -L(M PU`@0S 0S0Sz0Sy FTH DK0EUSP 8(@#h"x 0Ÿ, K8P 0S0 0010\ ("(04"43K#DNcx%c88ggp8:j:: -`RL@Ppp 6PK B6PE K*5TM 1CTL 1CTG 5T_5T (0CT :50SQ 0S_ 5To0CTu*t5T2 l5T- d5T[ zP5T <5T T1S/  3/p#5P 5PW  m840SW  0m9XA !4R/pWp40S-p0CT*l4T A0CT 0T 0CT-p0S 00S \p3T 0T ,0CTX1p3T{:0Tr30Stm3T 0CT0p0d3T_ ,3T\ 3T_X@3T? 0Tp6@p0s !`Q R@UR 0A0@0s `q`VpW@<9 0Ap0@l@(u Rp`$d@\0X\ @pP& >MPX \ ("(04"48#P R` \0R00ZV0@p0@0Q0@0@ pW  @P Z 0"d610P0S P GpP E( 4P0d0WA\ ("(04"40(li@Mi i"i >ii %i Ni4Wi@>>i Ii Oi Qi Fi!i  -QRLNMQ\! `1 `4P 1CP 1CP -(K0  0Sm0Sj1SSf1SSb R_3X^ 1CX[ 1CX0I \P P@QJ@0`SE0SBpK?V  >V K:V@T00   1FSK00K\!`1t  pX`K VXP80T@P40P@00L,0  XP T@ P L UP 8@KU0)D2X  XK U\!pWGpWD 0SY H`K UHP80D@P40@@00<,0 XK HP D@ @ < UPp1X0 VOKU  U$ $RKU\!6 K_K@@ U\\ U\!`1 m'1%!KUT00   eK_KU$ $U\!6 @F@ Ud00XaFuUpK`oU  nUK jU4iiii X:à 0 ( -L M`pHV 3PU,P  0 , PUX t0S\]@\YT@T@T 0S,0S+ 0iS PJ~ 2 R ,  ,0 R00U0SU0040 V00S  P00^00Se 4 R O0 ,,@ , R3 ,  0S9  0@hl*P hl* Z 0@hl+P hl+, 0 0@+P +,(K 0@*P *1@P ) 0@)P ) PZ~,0_,` ^RYʗR40S  N 0 0bSPR@}<40S9 2cKcX.j: 0-@LTP @T 0 R B7TPT00 -QL@R  UMRp` K\^0S[ .SY T 0 \J .\H ^I  0 a?R0a 0PK0KV0[ K A [R A0B0S 00 RNK K9 []PK4HS00 <0 \ ("(04"4  0 S0 a 0 p-LMJOK`sL0 XPK@ S0000#0Kpgg -LM⨠K S0 8 UddX@KtPK`Kp  pK嗀K, `pK_K|pK{K0 R(K`88 -1LS@ R hPGPp4 P2 GP 2PUU` _SP  YSP U" U00 0  00  0 00  00#0 UP#P P ?S  )SPLIcDIc -LMPpPDa0S"$K,1@T T P0-@T5P0`0S 8 _8 _0S 0 @ P `p pP@ P`p^8`0S 8800 ^8 @^DNc2c ::p ::H : -LPM⤠K @8R T\ ("(04`"q00K 4 KxKK  0  TW K0[xK00K` 0KtTK@0 \0K[ K(@ ,@ P@  FpW $K6@00@0 0`6@E[ KCpP ((<KP 00 Rp  I^p8DNc : -LMh0@S *l0 S:68JK0CS eP d0  K@ K=PRP 6`8 -@Lt0000#0 -LMPP T @0Sk(5T8pK4Q\08#8@D0`K#Dt 0BK80K7KC@@P ` \0R* Q\08#8@D#Dt 0BK80K7K(@@P ` \0R d0  JId0 0d0Kt X>G=t R>A=p88 -LM`\@pPe:U VT @T`00V00S 0S 0dS1!P00Sp` @P"J 000 00 0000!0000! 000 @TP Z J0 000\PZ0` W V00S \ p p W 1 1P00Spb 8#8%QA A0T@ @P"J 000 00 0000!0000! 000 @TP Z J0 000\PZ0 8#8%XU\EPEJ0PPZX 8#8%QAAp0,$T!Xp 0~,$8#XLpGRp<8#X8#8%P @@ $K 08#8%XU\EPEJ0PPZ8#8%QA A0T@,KrP<,$!$',, %PK0SP@ S2 0P 000 00 00RP& R 1P"[2[[0[0!0000 0!00P00S S 00S S00S 00S K\ H\ : :P P/0/Kc@-@000S S0P P 04"48#88#800000S0S S/00S S/00/00S/ -@L` pR! R 00S SV 0S PU P P (" "(04"4000S R W P ( R P\ ( -PRL`p, \9P 0S' );00@tOp0 0 =XQQPd0`0Q 4OPP -`QL@Pp P P 0S  U R 0 PA0 d0x@@T 30A0`C 0= P 040P 0 -pLQP- Q@ U< 8Pc`:00@N0 0  \=PH ``PW04P@ @,00 00SPD PP h@T1 00S S R @P  QPU,000S 8#8# @PA0 S` oNPPQ  $@T -L(MS0(0 PH`p8 @T6 0S0S0SU 0(K p `PDK RN(0 C0KD KP( `  @($T,0`01` 0S ;0[0S S\ ("(04"43K;0[0S0 p` -LM`@ 0R0% ::PH 0 0QR0%p A:W= PEU@ R0 U00UR   bfp% 0PcU@0@P  G (0K4P ( 0R:0PD (0K"P ( 0R0%p *YX.j890 /`j -PLU'@uM qM0  _PU `\0 00 pW  JPUTQ0 H00  0 00b0< 4 00C0lj`jhj 0- 0RL@ * !PP70㌄ᓆ0 M 0 0C 0 0 -|pL0Sd`001P LP 0 0@ 0$@yP00h g`jX.j -L 0qS00 PU 90P0C0S90`(0 0@(0,@GUP 0R*0S|`l0 R 00 0@004@ 0* 0R:00 o g`jX.jKchj -L(MH p@ 0`SP :U  0$0 |J(K ,0KP , 0R0%P *8 XDP.P*,0 00SL  L4 0Q00 0 00LF4 @ IL EL040A  L R  kP~  04 8<0 0@4<1< Q 80 0p@Q 048@ <,P<$"*<4 #:R 0r03Q0S|T3 P0Uc0UQ\X 0 00eSR R000 y @T00ǟO 0@ 0$@ǟQ0000 0 00b< 0t'00C0X 00@<' 0$@F0ǟ00G!0%0 0@0@0 $("(!04!48#8D0  h00@|h0l@@04"40d  0 0FV8&0S,Ɵ00 6Q6 QZDZA  0484 <S  #KP KP@ D\00H,0 ,8 0 D$("(04"48#8h("((0Q< 80 K08 0S0H  ğ00>D4 Rğğ0RQ0<00 5PH $0@0S00 048 0@`4dD\Pa~H00  L =GH L@ 8GL t0'P d 10 S 200S0C00 00S0C 0 000S0C00 00S0C 0 000SP 0S 1 0( 0*i Fp 00SL   `AV~V-jKcpj -LM0P @ $(,L<4,4" Z@`$Kl10TE \10SP@KF0 ?0K@ K8K0S6 ,( (pP d0 X0\0Z:S`P l0Z*0@P \:2|0@T (@TP00S00S, ("(04"43K(LcLc .j$LcLc -LM@`J K.0㡖px K.0㛖P K.0㕖$@0 PrQK$g : -LKM`*@KPKE`KEE0LKK 0KK0K0KKKE\KK E K E( ,0KA7,P (00,a1@KE\KK0 0KKE,|A(K;0[0S0SN 44 R O/K  B.0Е0 Q[0[0St\ ("(04"45KlK0[0Se\ ("(04"44K]O/K  B.0㬕 jQ\ ,0KP , 0R0%P 7*LQH3@P  $([Q 2 R: \KL K  ?Q1x@K4E0pK \Kw0KxK/E( 3`P 0Q @T \2 R0@2 R \KL K H Q\KL K (  Q  H DPL  1 R O/KH.0 B5\K@L K  0P0L0[SLA \KLK Dp3D 41 R \KL K eH PK0[0S@@NK(J( ["3$P$\ 0 a i0 00V 0 R O/KLK.0 B\K@L K iP5F 0xP00 R \KL K $L PKcDNcP.jLcLcܖ/d :$ :89pj :| : :4 : :8 : :x -/RLpMp0 P 00 S0% :Pf 0 ` P0 3V ,+Vg ,V V( 0R0% :PO 3V000011`PP 0@S0% }:P< 0$48#8 R`P<V 0Z0"X' hK#D0 \h0Kg K `@K,6hKP 7P 3 R} 0 00K▃Pk3@P $((K 0R0%@ J:T 0 0Ra`P0S 0S0% :P 0 @2  0 00K_P 0 00R6:0W 00KPP 0 0R':0r 00KAP 0 0R:0P 00K2P 0 0R :0@0 00R0% b*OD@KLKC0 L0KKKC, 4 LK@Pe 048 <:0RH0 00  L0K\ㄠ P t |0 p 刀 l`K $ 21C0!10\ X hK( 0K0@%084HU U\ :\0 0 000^ K.0@ 0LU0ESUU :V,$0}@P !0QV R,|$0|P  l7 R'V,<$0|P $0SV,$0|P  $8pQuV,#0|P  h+a\fVs, #0|P  o-Q0S0G SS0C,<#0|`P 16 0Y300~ V0  Ÿp8X`0@ 4$D8X 0@ 8$H#pjDNc :O89 0-PL @R 0S00S0 R  P @0 S00 0gJ$Lc : -L$0\*0 W*0 Lc(LcLcLc -QLM# @P`p, (  q@P, K  .fpf`, K $K -`L廢4g0@!0c48a0!0c4<\0P 0c4DU0 0c4C@@D0@ 00Q0 00Q D劢P@10 R 00d  SH,0 0C# L0 pPPP@ꫪx%c -, 0LRP*L0 OR, 0S*4@pD`@` @X4<0,0 H8@H00 Qk,x%c -LLc(Q/0( ,S  3S001 001 R0P// -Lw0h@0g$hMc 0-LM @KvuPLu P  0FK0 -L MQ0 03SP KA00 P0L/S[///////////////////////////////////////////4/T////-PTP0 PKh0 Khj`0 `. tpP0S @&5\00 P@< PLcX.jx \j Lc(LcMc -L4M@PP` 1KQ<R/ / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / // /// / / / / / /8/ / / / / / / / //0Q:0K ,uV0[00[ 01PڦpQ: &0Ku"[00SV&0[0(pQ:N0K( uVH0[00Q:0K tV0[00[ 01PvtH : p-PSLMPK0C`@0%T  @0QPp@p -LMp0 @$("(04"48#8(``V`!3T (P  1T +T (KZP*0V':.0K t,0[S! -0[.@[01PY3T0V:*0K t3T)0[)0[1001*@[PP<T000 -LM"0K@ pmt3T!0[!0[00QQv@P00U00S +u1` T ` `DsU* 0Ht Pt@ -L(MP @0 PPl}a 0 R - 0(@3T )T/  PP p3T0000aa 0V 3T T@tt2@P  (K<T<T t+T+TP l0 3 )0~P@|tPl02 @pt0 $(,0<,4#:(K= 0 )0XPP0P ll0(K/ 0 )0IPP0P llrL@K :L0[S@ S5 X,. )0< .PP0P llU8@K  0PE(@Pu  00Qm 1 )0 0S tP0l:K0[0S S $KK0[0SX.j 0-0L0@SP ڀS S s0S0s00 0@0@ 0S 1  s0T@00@ P @P00 0X.j -LM`Rp"@3 1:S? S VM*  hp  `bV @0SV;0 `bV(KV0PU:0 =0K 900 <4("4!<^00 >SM: 0V R*K9"[04"48#8 00@P  Ds+00h <`*0p@0@P0h @P+,0T0h `@0p@P@P,00h X.j -LM@` 0)S0p(P 0 0Q( Q0%(":P*0@P  (K( ,0KxP , 0R:0( ,0KxP , 0R0% *8VE0 EP00@X.j89 -LM0 ( `  !($ @PT@ 0$ (0BS2:(R 0S b[p K $00 (000$K(K0 KpP20 04$0S 0)S('P4 (0 s 0 R000@P  [r` p@0@P0@PL( ,0K:xP , 0R0% *4D(0@P  KcX.j89 -0LM40 ,Po !/ 0Sv  9I0@+9I+P`0@ {'R+P00`S6 h˟0 0@0@ $cq(K0SQ @Q\0S610@#P ( (vP 00@0@< :! 00@0@X*^6 `V0S) @T4 0S10S.0S+6- 00@) 0@99#= 0@8Hw 0S$0S00@ 0@V0SM ^ pW W T 0SH V0SR T 0S0S0S S (0 0@ 0@SV 0S 0S$0S S6 ^l W] W 6 ^ ^ W W 00S S$48#80@4S,KP0S 0S0S0S0 40 ,pK0 K40KEPw0 R 4 R $4 P000P @'UP0T@_ g@1 UO  2 1C 0Ɵ1 0 6PP0 H 0 SK @S,0\h 00@L&0 @00SJ00 &#= 0@8H '=0@%9I%8H 0@8H|^1 ^ W( Wg00S Sa\08#8 $#$("<8#8"( 0S0S0S 0S$0S[ 0S P@K 8P0  HKP0KOPK60( *% P? d0; 40 1010040 6 ~`K  .0@K؆ .0 ӆ@4 R6  0(B0 0S$0Sy0sß0 0@ 0@ 0s3 R#@0xß0 @@0D@\#0P`LßP@` ,0P`^ 00S S[\08#8 $#$("<8#8"( 0M00S0 48#H 00S 0 48#h   00SF 04B 6p,Ÿ0 0@ 0@00S4 04W.00S*1@'00S S  0'S 0!  1<1qP 0 40 m4`0p0@0@ R @00@ @0D@h00S< 00Sn00S| Sy40ST S 00S&48#8 0 `00SE 00S S 9I 0@9I.X.j hKc\jTIcDNc :Kc -L mPLc -,@Lh5 h;j`C0 0-L kP7 0lC1   R0@P*l4P4*0 R0S 8CXU \ L1ѓ4P4:H0@0@D(@ 0hmJATIcN\jKc:j0g: -LM1  P0S} 0Sq 0S0C0 0MRM. dqD`K0  0 H60 <KD0KCK4P ( X#P  ,0@`T~ 5 pǏPp`@ğ 00@`V0@@D rpK00 .0`K .0@`P, 0TP@ R$  04 0S0S0S3 PoßP0`@@ T@D  np ~(KSrpK00 `K.0㢄 .0㝄,@ 00@V@d0 00 `  `hp,0` RU 2 R d00@6E0S7 S{ 0Si So l 0S?0S 0 myUw] 0p1@P P  0 mp 00S0 0 0P R 0  0HP4 41@@P @D R\ 7P# P5 (P  0bO00S00000S S 00S S}P6 Fm3` P80`0@X80<@ H00@H0L@XDKcLcX.jx%cT::KcPl0 \0Sl  S303:lS0\0/X00\0\0/ p-L M)  0K@ `jPP 0T Kp00e  TK :TP TP 0S0![ P P!K 0Kjp -LM" 3@0SP0 Y 0 0S "101202(K Y 0 y"00000202  :2<2) 00K0` ` ,< $4 !$ 4,̂&<4 80 Xpl XZ 0p 00 000 00R[ R= 00   804 88!   4#8!8  8#8"QA"A"8#VK V :V 0S0"h0SP0SuP0Shq00S S 00S S *0Ko"F 00S00S@vi {i:j:j - 0L(S``YlpPk7Q PQA @@A1 01 4 1 H000(A00 (  ( ` 2` 0-0L@P!wnP01 0'S 0S S) 0S S  0h (KpP0 0S 00S0 0 00S00S00000S S 00S Sʚ; -@PLQ0005 R5 h p-PL`@Vl U  U U -p0V 0 00p0V 0  Qp00p0V 0 00p 0 pKc -HL@u10@00<0 -qPP.Q00SL@` P { [00/T00S00=T00S0<01T00S P { B00#T00S P { 50 03T00S P { (pPp p2T00S8P { 080 -L @ `Pp3 \^00S#D #DQ !(40S *Q/0/0/0/0/0/0/,/0/0/0//X/0////0/0/0/0/0/0/0/0/0//L/U P U U00⃁U#T P 2TP8PN{ P  0U R 0S D00D0U U 0U0SR @0S3{ P{  0U0 S<𩝘U0QS@𩝘PsU0 S𩝘0SS Ud U00U1{ PB  O0Q 0S 0S0S0S @TA  R00S 0SX0SU0SR 0SOP EP1Q{ QP  07D00D031. -LM@0pSP` @  @K{ H U0 -@PLW{ h -`0LW @0S , @K$h%@ %1 R 0S PF0S 6Qg00Sc^ P00S$48#80@ 00S%48#8 0 PQ  p00 @p0t@ P00S S 00S Svd0   T0S6X0S3,003X.j h:Kc p-LM@P 0`R :P" 0S* 0 @0@P0f @Pzp 0KhdP  0R0% *T0D0@P0  p0 01 pX.j89 -LM`4 Pj pPj 0p^PPb B_P[ ,t ( @@0( 0@0 0`0W0 H ,* B$XH  z$0 0@40`0``````` h$0S5 20K<2 W$ ἕ0*0K弒Kd400`W00@0p@P@P p(K|] HD 7$X 0$ 00S ` `pjXgP8 -@LT @T 0 R40S C R004   R000 @T蠏g p-PPL0Sp80 @`T  @Tphꠏg2c p-@Lϵ ("(04"40 l`("(04"400 PR ph #P 00S NcNc p-LP㢵0@8#8 Ġ#Č` #P 00S 2b00 40 00040ph軶Ncg 0-P0P@LMKP0`0 00Pv# 0@0頏gPgXg -LM 0R0%@P :U$  0S \ 00S,vpP 0S Sx ] ,0KbP , 0R0%P *$j/ 3@P $(60S 0S|0Sy0Sv0Sv 0 $("04 48#8! CP\0h8#8 $#$ `Vj `Vg 0 R  B"P 00S0S[ 0SX0SU0SRXe 40S Sᤇ1 4 1@0S 00S@ `V `V0 0 R B"PV$ 040Sd 00S0C 0 0]0SZ 00S\08#8 $#$("<8#8"( 0v0SE0   o"P\08#8 $#$("<8#8"( 0 0004q89pjMbNcgh0GS S S // p-`@L(PY"0V00@ 0`p -LxM   :  R  0  00 l2 XP P0S 0@ S*t0@PS 0PSX0S{ 0R @3@#PJ(K K @ Ki# K|Kl0h0 x H Kd0\0 h X 054Kd0sN !\`Q R@@= 0Ad0 `@ |0@PP0 p 0G0KT t`V$ `08V#8 0pS:D@K!0 C0KD K  !`08VP#8K@ 㺤K!눐 XzQ0@d0 `@ 0@d0 `@ P@HNc -LMp0 剳W, 0`0P`U' PV,`U, W,0 Z:,{!0 0 e*0V(02,200 @ %"P,`UWP 00S P3P#,剴(K;j S-`Lp@`PQPR00S`RU  sP ` V V*`  + `P00X00S U  R` |0 -8@L Z00 01 -L p0`V 02P@T 0>CS0`Vh@0$E D V0( #5#30700;j2cLNcMb -|L 0H 00 @;00 #5: #30/0 00uMb P-L \  R @T 0 S *01 0 S00@ 0(  ,,:: 0-@PL` 0S[ 0SQ P d1 RMX1P U 0SCP0 Q D@K  (` x0(0     0 0S S 0SD +"48@#80 @@2<2 0K0R0 @3 ŸE> 0@P4TD(K( PcPf1 R9/ P1 <10* K)0K%"Kg+P1XO PP i@ 0 @@ 0P 0Y1 0 i T@H$H04$48#( K.0f0 D"D@K9o\0 8#8 $#$  5%  0 !`00Q0`P000   0 00 0Ba 8,R K.0 @De8@0 X!.0,R K8e 4P80,0 TNcgKc\jDNc;Mbl:8:h: -LM@0P <Kp0  LK,P `V 7 RQ7@P \N (K 0R0%P R:U \pK 0 \[48\lQ \ &300  L0[S @KH .PL0[S |PP@ 0PA ᬸ0P 0@[ q PD 000? K.0d@ K.0d8 0 d   ,0KSP+ , 0R0%P *| [0[0S\ \("(04"45K5 Rx  K.0{d 9 n M >qP5@P $(2e K.0]d  [0[0S S4 RD  @|P{4 R9  5x4 R <K P@4 R# TU i0 00S 4 R  K.0di0 D t0P 8Q 0 R 1# S ;i @R@U@T} 0i 0S 0@1T P00 8#8S1d00d0P @PTX P 0 H  0TMM0 PHU^ 0SR00  U  1S501X2y.0!U* R  K.0c@80 NU i0 00i ?Q0 0001T P0090!0!R00S0 1d00i P  @@P`RP 0 :0U00S  0!d0  b0"00 R w0"0F @0!>DNc8.j:89:pjt::H::::8Nc :Kc -LAM@P<K $  LK6,01 P 0R0%P 7:UE p\K  \K `V |V0Sh0SMd6@P 2L (K<0S080S-40S*00S'$[6R U0S {S  ,0KRP , 0R0%P *5@P $(l <K^PcHU0S LR*@K.0LK b, G5 R \K .0|b : K.0rb@C/K.0lb8 0&0S <K K.0\b v<K P  <0S 80S40S00S K iH0SxD0Su@0[Sr\0[Sc S( @KH ZP` R0! 11 0S  0S0S0 s 3X R S0S( 8[0[0S\ ("(04"45KL [ \K! ݵPp`P`1 lK@X i0 00S dR0S \K K.0a Ai0\gR0S <_1 R~  z@Kt K( 00KK@Ph d0  00 RS  ^!<0RPP@SA "80S40S00S`00$\ ("(P00 Ġ"Č2\ K<K K2 @1 <K@00S@0`0\  0<K\ K <K K.0Ta|  MPP 0pa `UKcDNc0.j@:89pjp::::::0:::8p:/tP/0S/0S/P/@-0s l@0@0s H@0@0 @/0@0s0@0 @x%c p-T0L@`TP @T 0\ R Pp;j -L`M0P\` 0S K rPd0{ x@K@d0 08KH0 t p l 0@ `uP# p-0LSP`p00Sp\08#8 $#$ M0@t ph胣x0 -Lhd Q 0 R  0Fq |0@0@T0X@| T 0@0@L0P@0@T0X@0@L0P@DNc:x%c -LMx@p8Kᱳ QPPf d T]80K0 0 K1 0K 0K00K0 840 0`,X@  @ Ԁ @, 0000 0 0000 4 0000 8 0000 0 0K8K0K0Kh0d |0 0B00 孡K@ vPUQ K۳@P 0 N1 RT@(K0H@K0 0  ᏽ8H04D 0P,`@0P< P`0`@00 0@K 0K8K00K@ sh0d |0 R 0|  R .t ` | `0 R Kv K.0_0 @PV@`08 M@DNc: Ql:4: 0-\0L@PT@T 0Sx x0RP 0HNc p-L4Mp0P`1@T@T T p0 x0x RײP Kp@T@T 0 R0SpP Pp00p0H0 R F K.0!_x0 8HNcDNc: -LP|0P0C|0PPY 41 RU r K.0_[x0 8PFd0,p S l0 , KPP 0 R r K.0?[,x0 8 0(,pW%dhdh44   | WRg jx%c m8DNct:: -LMK@ HpK d`K  PK    x@K0 @H0KG K0Kd0K Kc Kp P ` h @ t ,0K P0,t ,D$(K -$0L@T@T;j -LMHK dpK `K  K  @  x@KP0 HKh0 KdKGPK张 ` p PKcPKH0@t8 ,0KOP0,t n,0$0q(K -L+lq@T; `P d0  V9 $00S0U  RPU00S'@TV5 U  t0cpP 80S 1S@T`V U (ti'`t0?P 80S 1S``ӓU `V`;j: -0 LRP0b( $0Sp* R 000  0 @T P @TpW r 00CS 0|, h襮4$0Sp p 8 Kc;jHNcH: -0PL0r}0@\`PN BTf $0* SB* 00 @5 @T6 R00p00 0\ @T pP@T iP @ 0`` 00 0{00  0``N@KTg2S 0 R 0R,| `P `8=G`d0  ;jLc -LMP 0 A< i0 00T7 2 R( <K K.0mWi0 D( ,0KFP , 0R0%` 4*@L2 R h@T 2 R  <@ @ 0<K @@0SN SH 0 SX [K 0 VK_1K`Kl 1[ x0301K 1["# 001K K0 $ (,< 4!4"<1 0 $ (,< 4!4"<1 A Q YP@4  @.00S0 R&  K.0V @@T <0 R  K.0V 0L@ XNcDNcH.jL:x%c6MbLNc::pj:89t::8:d:k00C0S/6@/% -d0L  0 0, 0Bh\Ncd0 -LM`i@T@P~ R 00 000Sؑ+c@q @,@2t <2( %00*K"K)@K0 0: pp @@@@ 0d0`0 0 * B, (`z0(0@@@@@@@ P+ i@ 0 @@ 00P 0!0@0 Hi $H 204$48#("48#80 Ǘ@ 00KP@e8= 0@@4DD(K?h8pj 0-0L R0P0;S000<S<00p0@T@T 6@ d0  ܨP G@T0h$\NcXNc2c8@p@phӼS S @phP  ?0 0 0@P @p@phP 0S0 S [@s> @l>@i>" --LhM`0 ,0 Y P0 x@K3 0 pP@  >Y xK >(K 0 :R ( cA`P# 0@ 0 @ P p 0S 00( |0 EA`P$C`P7p@0K 0FpP00 p0  0#$#̠`#8 0v00厴 0 :R0 q 0 R:(00K (DP`7p P0@0 ( l0( 20H  0p :R T0@0P 04 e|0, 0 0@0@XP 7("B 1@W b`0`WK W300 0 0  0 0 0  0 0 0 0 0 0  0 0 pG0 W `W 0 R 0,8(2C"B0 cbR  0 R h0\\0L'82C0L0c00 P @@ R,B B[q p-@PL 0[! 0$H8L(2C"(@\`0%H c@`Q AAQAA,0R+B>.B0 BR,B Bpq/80@-Q@0R,P0 0,0,! ! 1!4##!#$" " 1"4##!#$""1"4# # !@D#$""1T"#T P0@T0,0!," 08Q  0 "/ p-L`P@@Tp -PLM0@`. 0IK$1  0K0R0pK Pd@0 Pd@0  Pd@0` `&$K` S-L@P`0 @R1SVPQ00QppW(,0\`0p(ST0 p,00D ,@0`F 2$, L!P0S,V\,KX03/`P 0 Sd080,0 09 0 .PE00 0 ɟT0 0CLPX0 008$0d\Pn@2C0PS @0< 00@< 0 \RP@ (=0Q ( 0 40<0 , <0 `0l0 $0 #44$p0,0% -$PL4p^@F (\ 0@c T#*0 ``T*:d b@T*00(0S, 00000R00#3,05$ 02,0(00@c T: lB (0,00 d 7`4d 0(0,00@$`0 (P4 -pPL`@$PU 0S0 S P00( T b4(0,00 04d ,@0 S T Q0P -LDMPT  8 8(K$X PH QL  \ 0 @D@ P0P 8p<`<@ 8 S`000(0X0L000$0000@00P0x040H000L0000d000T0H0<0V_ L`F0zL Z0Sp8 ? 0 0VK L `F0zL  Z0\"'`?P  Ud 'w\`Pd JRh? 0 0V# L`F0zL Z'4,<'<$00 0 p80 0Sx  8T\aH  D00L@P(08pS<0S  l@L0T l0 T/^p0P(P8 7 0 07 0 0`l0pPX0Xd 0P P8 < 8 0 0G-|M00\`0 S\ 0 |0  2R0 Q2B@P0 RPU0@ @@@ |ЍU p0 RpW@0 00SJQS03<X 000Q\ 0|0 Q@ 4T $D@0 ^U010!W0!P808 0200@(0@L @$0, 840p  0@ , `Tp$(ń0@p@`p0 4 01# 1 l!c0  ll 0S@BpB @0 D4  4Q40A0 0440|0 2R0C8#(@Tw 000|08"C^B4 0@ T< P`0U |0S (aR  00 cRU  0( 0 [S 3 "R< 080 0  0bC1 @000000d0U0P0S PZ $(,80>P00[P030"S @  7 4^)  P0 4 @0S80 0  04L0#04 0 @!@00 4P @0 !0084 0@00400@̠$0(@, 999R9P/$ R 0S/P-$^ 01 0C$ 0 B0P- $P | 0  !400 / 0-@PL0$Q P*UEU IU[U(0S 0,$D0S 0,$@0S 0,$80S 0,$0,qU0$00gUqU 0UG-p,l A?@0CR0Mx8|P0A?00`0`0, \0 00@ R 40 0 0t%Q!\!  00 RY*PUW  0 ^@ 0@ST@ 0R 0R`  0R' 0R" 0R 0R 0R 0R 0R  0R ` R 0l#PD 0@H08XT0 H4."D H @ H0D 0@@U*0*S -PPL@$`Q00V0SQ0Sn 0Sh  :TRpp Wb0S *R(0P(@ ES` IS [S gS. Q TRZ:Q Rt0ST 9QN )21C00@S90PPpp,P0(0,0Sq00 0S y8 0 80 #4 0 8q000S 8 P T  0` T XP ZC0SSM 8080 #4 080 #8 0; 0  0  "4< 0 "88 0 04 0BL0S0c00s3Y 00 S&0B2l 0ĀRL'  c0#2cq0 a0aPl0S 8!IF g800SS@SP >R |6 0S   0p W p  0 S,0S ^* n838 0 \p,0S ^#:W0[0 p0$0S  } 0$ p0 0W p  0 S,0S ^a:t 0 \p,0S ^o:W0g000S 1 R !!* 0   1S 0 S,0S \"< 0 \ ,0S ^* n880 R I00 0\V n88 n88g00~[00v 0SE}8![X n8~8 w8 000C 0 }0 0^m , 0R  S $0QPS 000 0 0  0#4 0 0#8 0 0   R  0Sg   0 0S  0  0#4 0,0SB E0 0 I00 n880   0   0  R 0 0S!0 00 q00L0D 00pCL   BD8 8RʓR0 9H 9B -LP@P$`V q@0 T00?Uʄp吐"!B 0h 0 P  0 T h 0 @ |P p 9 -`tL\EPPUl8 H 0XT 1#D04 H00 @ H0D 0`p0Xd0x` 0\*,0lpA?C0ChQ 0BSW``0Sxlp\`0 SdTTT4aLD4A  !t@(4, 0! 0A9!0P933;ӗӅ@! 0@D00tx0l#3LPlptxpTlp:8 H 0XT 1#D04 H00 @ H0D 0lpxLQx0NUp0`0hlp= tBPPXatPUZB UPh0S 28l  @RP 0C!@ 909hP\l P80 `Z00e l0\00 RtZ\ R80 b0Q l0\00 Rh0S( ||18  0@R0`1  @9H!0900CQ lptp@ lpt0Slpt0 @hl0t \l P80 `0 l0\0R0 R S xp00c Sx0`0 lpQ`Zp 9p 9  -LPptDQQl8 H 0XT 1#D04 H00 @ H0D 0pWl` ,0l`A?C0CgQ 0BSl```\spDCD3a83L  !3, 0! 0A9!P0922;ӗӅ! 0002 t`0 BQl\t\PZ0L`0l08 `l` 0HX T2#D04 H00@  H0&D0 ` p BR` l``l`^j \ R80 b08 l0\00 RYxx1 8 0@0`1  @9H!090tl` 0CA`Rtl`l`8 `0`0l` H0XT 1#0H0tQX Q!\l P80 `X00l0\00 R XR5Q3l``-Xp 9p 9  p- 0!PCUQL@`tP7l0\0 Stl0 P0`Qt08000 al0l0\0D0 R l \,0 aA?C0CR:Q800l0\0-0 RpQt0p03VQS \l P80 `V00kl0\0 0 RVpVp 01P? "# $P 00S /P0S p-PPLp$`V (0S ,0S 0@0 @0@040  0R b R0q0*0R0,  E@8(@+L0D, 00 < @CL   BD`21C 0 0|` H@l@\@t@x h@p  9 -L M P\p` (K0@R1S  P(0 S0082(0,0S,2,0qV`f, V , `F, 0HSUV00V0S Y00é?Z00ê?40 0[-(V `@P@ 0Πh10 €0 $@B, 0A 4 TP 0`,40Xp00 L00(8, 0(@L 0(0#`D 0 (80!S  @0S D0S P 0`\ 00$P儐删(Ko404 00 0O_3131H 9 -LM@ 0 0=K/|9/0`/H 9 φ 0ቇ 0Q09  d0xQxA H0LQ40 , ,0 0/ | \0p@-P0P ;L0`&N,;<0 @P` B[$0K8;`p@`NctNcNcG-X1p0\;^M0100110\[`1@ 0T'+ 0 P\[3P`1!0 \[\1!@0T:`P@0 R P0`T 0\+Ѝ0<0 R0 P\[PXA-\p10  W@ `P! 0 00P`  ^`  P0EW10\^ \^ V L! 0008 000 \$ +-Ӳ0Ѳ000²0Ѳ0| G- M0@SR 0 0`1V0ಐ Z > VEP 008#88#800 "$ 0 c\ 0C0PU0:0. \e0nPLuʰ 0PU00*Y   Z  0000C^ Zh \$ 10. ⨄pP0gUڔ058#88#800 "$ 0 c\ 0C00`F,4 pP0gUu $058#88#800 "$ 0 c\ 0C00sPUNڐF058#88#80 0 0"$ 0a PA~ VA$3pP0gU+= 0%r0P UF058#88#80 0 0"$ 0a P AM ЍTF0 5 0C4Ÿ82 % 2pP0gU/2 %qP UB F058#88#80 0 0"$ 0a P A T0 5 0A4D!058#88#800 "$ 0 c\ 0C0p0P Uʸ F0 5 0+-058#88#800 "$ 0 c\ 0C04p0P USF0 5 0 0@-0@P 0CU0 0 ! 9090 0@S0p p 0<010)EQ )<0803ӗӅ1(0  p 9p 9 G-4@ MP '!0t`P0fUڜ058#88#800 "$ 0 c\ 0C00,4 Q*04 0CⲐ Yp 3+ 0̣` P0fUڸ058#88#800 "$ 0 c\ 0C0 0\3QU" 8#88#800 0"$ (0a"(R#A IX223pӗqӅ!0` P0fU}t058#88#800 "$ 0 c\ 0C0 0$2QUq 2  e^`a`0>8#88#800 0"$ (0a"(R#At1  QN:0TkpP0gUF<058#88#800 "$ 0 c\ 0C00 0 Ѝ0 5 0S00 5 00x0 5 0X 0 >0< 0 >0Z 0 5 0p 9|99p 9d99 -LDMh 0,& p`W6@L >L @0 SU 0 5 L  \ˁ\@ 0S0%L0h 00?@T  @TQ=0! $ş`K 10\ B ` ğ` 0Q0CC!10 \K \  000@  0S 8#8  2 P 0 0 `{P4p R@`   B10 \ h pT X  \ 0`0 3 \㳐3 ! \ಐ0PU1> 0 Ld A010 Wdd 0 T0SH0`0Yil ,0Xl \0@װ 0#!X R 00" PUdQw G@2 R 0> 0 0 Q0CRA l00 B 000d0 0C BSd0 W> 00P0 K P R 1> 00T!Q@@PE 0Sc0 N!! p^P Y BP p( IL !L 10T\ @ 41 B8QX 00b0 0S0L0Y H K 008#\L0S P@ 0^ `(K 0S08#x 0 ` 0R(K0 rC LPU@(KP=TX< 0@-P@0S S0t0 0"$0C0 0< 0 #40  0 -bLP@ Uzژ058#88#800 0"$ 0a\à A882(RpgPPŸ+0Რ08#88#800 "$ 0 cZ"0C0 0!a0P 00eS' U:x0 %`Q XLL0>8#88#800 "$ 0 cZ"0C0 0a0  ;㳠 0 0 0 % 058#88#800 0"$ @P0a\à AX 0 >0p 9@-0@0Sڀ  0#4 0 L L000S00 0 0000 -@L@ ^pP`A 0>8#88#800 0"$ 8 a#8S2 A00  8#, #808#< U0 0 \  0 >0 -LM`pPP00 @2RU+q&(+lԅ@010> 0 R@DT0ş  5 0 ^ !0S  W R0QS38#88#800 0"$  8 a#8S2 A0,S@ T J048#88#80 0 0"$ 0a P AZ㠂P 30 10> 0 ("(("(  0#40 P0b\à B U  Bp P0 10> 0P U ,0P&M C@   00i00S(K00X048#88#80 0 0"$ 0a P A00058#88#80 0 0"$ 0a P A tJ0 4 0gT0H . @4A0 5 0 Qh9p 990 ##/ p-L@MXPKX T0 H `l @0D ( 0 , @P KpP@ FT@D@00?@|9 -LMO- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPbin4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484< / p-L(M@@KP`( Q 0@` Kp p-L(M@PK@`( >0 @  P  0Kp -LM@Kp 0oP(K 0fP ;P ( PK 0 P<@p2lP0 H D 0 ,@ L  P 8 <00A5PP  PPq 0PKS< @"|4 8!| | 0 W5  |0@ S<0 E<0!S  0@ @ 0 @<0S! 1Y - 8 R0@ @ 8 R@ B0 P@` 8 @00  P@`0  <0  | X|%@ 0 4 8@ T:`:p::h:l: -LMP@pP@j 4K(140} 8w @K< 0`P%K |0P  XPD@ @P H@PX& {@<0@ D0x:T[1Nc::: :g:::  0S3/1P/ᬏg <4("4!<S / 0-@< (4"4!!<SL P0 <4("4!<S  8#"  <4("4!<S <4("4!\U$, <4 ,$ 4!$,<.,#1"110 <4("4!< S -@PL P  <4("4!   8#"  -L < 4("4!<S @0 R/ <4("4!<S/Oc -L@hQ -p0L R <4("4!<S< 4("4!<SOc -@L0P0c謏g -x1L`Pp  <4("4!<S 0P< 4("4!<S$P kP< 4("4!<S <4( "4,LP0h0J< 4("4!<S  8#" 0Oc: -L_9 < 4("4!<S h -1L R P  <4("4!<S 0< 4("4!<S*0,$,!$#<S  < 4("4!<S Sk< 4("4!<S Ocg p-LP`0P @PT00SP00p -L@$0 RP hOc -@L0P0c謏g p-0L@PPp <4("4!<S~`< 4("4!<S  8#" P 00 <4("4! pOc -0LM pK P@` plPT (@<0P@ P@   鬏g:: -LMp $ K `P@P TT 1 !$F`PP*P$  @@P$ P$0g@꬏g: p-LPP p0,a @@ <4("4!<T0 -LM@0 KP <4("4!L p-x0LM K P`$@PpDbP@@z0Pd@0 @꬏g: p-LM` K`PP @`P@@U@@ 6PppT:0 ꬏g p-LM`KP @PP 0 <4("4!<S @P A@P 0P @p@p :: -@L&h -LP0 b謏g p-LM` KP ATU   <4("4!< 1 T U p0 -L@MP\ YPT d< Kp<0S aVT@, KP,0S S T0 KP00SS(K4 KP,040 P40SS8 KPP8 R` R,04@`@0 0VD@ P z!1L0 X 0a\ H0 ah d <D0S <4("4!<pU L@` R <4("4!<P`: d0X-) \0 P`h0KP`V!K D@@  R <4("4!<P`@ h0K0S@h0 d@ \0@T\@WH P@ 0TX0<0 0 <4 4,<@ P` <4 4,<@ pY0` 8 tU 0 <4 4,<@ P`::: -PP00RLMZ@Ei0P80 A , KP<,0S9S78\0 KP100S.S,4 K0k00,`<0  "# S!ʒ4V <4("4!<@P0  <0 S<4("4!<@P@ P 8 (K0 <4 4,<@  10 <4 4,<@  ::h: -LP0@ R@0/S0/S S /ipP @P `ev@P  P0PS /S ~pOc p-p`0PLP@ T R@P P0cpp @꬏g9 -LP 0 b謏g -<@0PL,P0c#P0c謏g9 p-P@L`\0T0- P) @< (4"4!<00  <(4"4!<00 <(4"4!<0 0 0 0<4("4!< 0p p謏gOcG -0Lp3000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A Rbs_notimpl_%s: args at %p-(O @mmap@r_1@r_2@r_4@r_8@w_1@w_2@w_4@w_8@rm_1@rm_2@rm_4@rm_8@wm_1@wm_2@wm_4@wm_8@rr_1@rr_2@rr_4@rr_8@wr_1@wr_2@wr_4@wr_8@sm_1@sm_2@sm_4@sm_8@sr_1@sr_2@sr_4@sr_8@|c_1@yc_2@vc_4@sc_8 -p@`@PP L8P$1( <0D $00H@!0C00wwww 0-0 lA  $0  LPU 0hM0  !$ $ !8@0@!x1*4 x x!40P0C0 K\?j GjAj@[8$ocHcL :OcOc=jЕih :g -p L@Q00 G hW4h0  "!G Oc : :@-@Q >0^ 00\R 00$0(000/ 0C-L`P Sd111<1111111DAP hAL d@T l0 p pU W@ PL d`bbh@ PL dZ( ` Pj @P hP :4 ^ @4: S" 0@ ::00 ^ 0Kp -LM@`Tp*  R $ PR @0PS L   0 P  @R(K @  -LM< \p 0P 00c80 0儢Wu `lŸ Zw0 K40K 0 0S} 40 Rm >*"*0L,  080< P @,T> 0\:00Q^ (KP 00b, :#: :cS1!\, ,8  000`Q!0S P 0X>20,0,0pW ` 20 0@T\ 8,0 0 S0@ 0 , K p 8("(8Q, "*46*, (00S 0 Aj  -L$M$( 8 R`4 080 0 VR"PpPP%4V@1,K080K  `V 00pR00SP 00 4 $00( 0(K -LM`$(p Q,0W80,  PP p 3U00S 0S  @,K(K QR , 0 00$( p0$K -LM\@P$(`3*KpȌ$  K$K pP$0 0 $P(0`p.  0 8<8 -LM>0~0p0, @ tP  , 0R`$P00U*W 0SW ` 0 Z0SjzG, Y@ f8(8<88Aj : -LM0(KpR(0 $ &`00^*P0.Ơ\x@: 0c#\2 050:00$00$  $ 0S`V< KHj i -LpP`  ,@#jP `P@0  000$0(0 P0@-@P# T!00Q:P  RR*> 00 0 bR !. .0  00 >00 >a 0Q00> 000G-PMQ$(704S3:0 8PX b0 0V4 p 0 Z `1`!R080V; Q @T>0.\ 00R^ ЍQ 00l:#: :cS1!\  000`Q! 0S 200,`V a  p ZX 04 (00$0   P 0Y 20 0@T\ ,0 0 S0@ -LM4 @80  !00S 0 Q Q̫1ԫ11ԭ1184x(K$Dxp< 8 R,` PT:`@ePU40p0W 4^ Q:>0 >0 S00`8 PdUP!0 >800S80 @80P,p PT:@ePU `W:pf `V4 00Y00   ^ Q:>0 >0 S00`8Pd U P!0 0gUP!0 800S80 q @p80P,pfpePU`V@f`V4 00Y,0   ^U Q:>0 >0 S00`8Pg U P!, 0dUP!0 800S80 , p@8P,`$`@ePU4 0pW W Q:>0 >0 S00`80PdUP! 0~8\8 @ Еi=j(:00$*!00xP@xl0 R0 T` L0R  K< lx00 @j00 `+.  0;>0 0x0 Rt 00PpT` P0R  K@X lx 00Pp0>0S00 q <>D 0+ 00)@ 03@xŸ0SxD &D JZS D0@46ZS#PP @): RTP 8#8ZS#=)6?>14@D0 `p `V@# WU>000 x"Q0S T` 1R , K, l`xV@D0J8ZD0 0(K)68; D #;1 4Q@x(0SD *JD T0` 0R , K, lxnT` 0R , K, lx\0\ 0 <0 P04 080 2 <5 4200@jt@j@j80< S @@0(@ P@K(K4G븞gg;HcDGjGj M|KgAj,:(-:0' %#&R*:0R'*0a 20 <PP 0T0U 0 @00@0  (F#&R:0R: 0a 20 <PP 0T0U@00@0  D1x81 R $1T1` 1R , K, 0l0x 0j0$  0S@ 0x0` Rl0,`0T` @0R , K0, lxHj0S< $#&R:0R0a0#1521000*< R$ @0< 7\ 0  \~ @ @p$R4 SD0SH  0R01X'0QU@0`0ó@0`@0`] P` < 0@V 6 Z0 0 4 R000$ $004Sc V 6 R 0R 008 00S o<QN $RD4S<SD0S6H R0R01&0AT/ 5V2  <<<@0`00@09VI  @ @@0`00@0W@d <@0^ @[<0H < 4< @0`H Rgg4S[[4q 0S  l 0Si  4Pa0S 4<  @ @p倶008 d0TDx0S44 Zi 0f *:$  0SpZ x0CSS T` 3R , K, lx?0SA t3,<WL0P00 0P V <3 Z(30 0 \ P @ @p$R44SSD0SH H R0R01"0AT@0`0ó@0@0` `"Vv  @ @@0`00@0 P`40 0Sp  0S r 1PR<<@0`0@0:@ S@Pp P ] !V+   &8T` h1R 8, K48, lx8 <0< @g 0PSt `r40o Wm 0Tg 0S^ 0\X  @ @ h0LK 0S D0\ ,0L0l@jHjAj@j9!00Px0eS T`5\, K , lx@T0D6P0H8@>9@5p:#:S/,5,%0PQ,KP} '*(":10"P 2C 0S0 ,00*"%0㔤0@x0pTS*/hP :*#:"*S6*H4H$0@Q  05!P? 4000 %*(":10"P 2C 0S0 000*"%0㔣0@x0pS*Xd#0@Pp9X< PX43<#0Q,KsP p2 0 P 4, <!*(":10,\"s 2C 0S0j <:#5  X040 x0S]*<塦x0S <T` 2R <, K<,*lx  8 21C <0f0000 ;+ 0 0 P 40,0 0KPKpT` 1R 0 K0 lx 4T0` 0R 40 Ku40 p0ldx*T` H0R , K(], lx%@jP< m 0Sj 3/@Pᗯt OK)2~Ϡ "K(2 $ ȟ&<0 0<PPZ0S? ``p p, 8R ," 60Q*42@02 " 4 1 <02 P4 UJ,," 6`0 pS1娑XA964|;(K82L!082 08",S00S, 0ES-2,2,2+2+2+2+2+2+2+2,2+2+2+2+2+2+2+2,20S @0SO "8"8 #$|tlu3~p@g00^0L PgU@`H@ $@K,0  $ 40RZUzj KOcAjH/:_ 0-LM   $ l(0 @!P , 0.@֢ 0@!.@ @1:40  4P@1P@E@0@!P 㿢$Q( 0080h0E   40K0x]=j1A- QQQQQQQQ RA- 0@P`pQQQQ R@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 p@-@P`R p0-@P0/R0-@P \, 0L 0l4 @P0/R0-@P \4, 0L 0lRQ@P0/QP:/// p-QLM@P` S 0Vp pppS`@rP`&0-@P0/R0-@P \, 0L 0l4 @P0/R0-@P \4, 0L 0l51@P0/ p-QL M@P`S K 0V Kp  Kp K@rPp`(Ƞ 8!"(,Ƞ p@-@PpS`b `c0#3 Q. a l^#(8.(030# 80 (3#0"P@p.8BA Q ! C2Q -L@P-S'pU#`S PW0#03d g0U f  e00#2 S06"l P@X t@P` r0(@pP@-` a@ \B/@-@/0@-@QP a0 120^0 0100 -L\M@P`p `5`^0p(KSP 0W p#83K8#8ẃ[0 X$,8`K("X&3KK0<AZ0@L0"[[[2[x h[[$[3[xhHPcp@-c@bP`T !L2pQ:P:/// -LM{ -L MKsK K0-@"P#0/40 $ R/ ((0"4S/nc40 $ R/ ((0"4S/nc 0/nc( (P08#808#80/$0$$ $P08#8 /d@d 0Q 00/ -0L 0+R 0  hl0l嫟P \0 RPh PD0D @偩8~0 L=jAigocP/:ocA24;_8H :X/: - LM0S@00|P@@ uPx@pp0 8`峝Ph<_P, @ococ/:@/: @4oc0ocqc/:p@ Pp-L 2R 2 pB00|b 0够0h"S S00S@P P0S S00SQ000 S0 S APSpP0-SQp@00ACSCF2F2lF2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2dF2 F2\F2TF2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2 F2LF2壨0Q00@p@ T T0 H @0 8 ,0 DSBOgTGj ococ/:/:/:/:oc/:/: -LMPz G.?)m0?`S P  A 0`0S @   00FS0Sh 8` \9 T9+RL9L)D9*  18)89 g  9 )ɟ000  'Y $3I@ȟ䘟ȟ bx @``  尨 a,Ơ  0P`X\\8 @T:00C)0ݝ0P0c1*U,0 I@9#9S @0^:7BAD@L*彝0 1P0b*U0`X I$ITlǟ0 C\XW:0p0C *0坝(0 C\,g:0 0C0$7*㌝ǟ 0B1\0a0:0 0C06*uƟ0|Ɵ 1B0a\0}:0 0C0p6*]\Ɵ40Ɵ 1B80a\0e:0 0C06*EƟ0ş 1B0a\0M:0 0C05*-şt0 10b01l%|-`5p)Tşd% 0 C^&:<5L*$UA E2T PT?C ET P4@D0T@ ğ^N@P`@&x0@@  0e@yDҦ :@o :@g :@_ :@W, 9@PHC{o  @P: ET, iX3 0?? 0S  p   : 0S X"0>0>02 a(2"&  0]xZt1,!x1(l02,"@$AN<!t1+!1 1!1 =8! 0 ,15#x1 0 p 00<0 (K0徦,弦(度@8oc/:Q@APpphϣͣ20 @ ãx弣p幣h嶣20,X屣 L季20,D4::t4:5:4: 995:l5:4:2:T5:@5:(5:4:4:4: -0L0S S S@ 0T<8 @DkP 0'0g5:@B 0-00L0p0C0SPࠃ @^   02020 ^|[2|[2[2\2L\2p\2\2\2[2[2[2[2[2[2 0$ R0@$0 @@@@X 0SC <0= P$RFD1R;B0CS0h<0= $R2 1R:BSV@< =04R SV@@ *<0= $R@@< =04)0"0Q] 0CPP7 04SP1Z00n 00S= ;<00S9  R00 0S 0 480 00S$ 08 <04@P(K  0P&PP"'P0 SP R00 0S 0 480 00S 0 480@P.9 N -LM0*S$ SD AS S08 <04@  (0, $  S (S S |堝08 <04@ 0$ $K0 480 @ P``0S<0S P` 0@,P (` ,H`P,0Kp0@PD0` p0@ L#D <P`0@(!(D#Lp4  0  8 <040L6: -LPp`@P P 000$ 0"U0P  0Pj -0LS@`MPP `H ^00 R00 A ` 00  0#40   0 0`P>00;000` P`80:0 0p0 pQ00( R00 R 0)P ؖ0 00 0 000000C2Cp P 0 0  `P i` -0LSPpG 0SpC `P p>  `00 P700;000p PpQ0:0 00 @ @[@B Z (0Sz2{2`z2`z2z28{2z20[0 R 07P ` 㘖P p 0 00[0$ 00b $0[ |o Y (0 0[0 Y (00[00[0 kpPp: 0-L`\P L1\ D1\08!Q+ 1\( 1\" 0\% 00\ 00@T  04/02 <008 00  0 000h40h2` 022 022@02 202QQQ`-9 Q@/ 0- LP|@ 0\ 0| 0\004P/P 0S0S/P/4004/4\040/ R00/R@-@  R R R R R\000QA S S S S SL\00\ R*R Q 00\  R\R R R 0B0_S Ĕ\00 "#0  0@801000  0  0  @000/00C0S0/  3 -P@L ` 4Pp@ 0@`p0P Ȏ -LM< \ 8 40  -(K8[\8K0@$L`X80K@0L p#D <P`80K@0D#L4p 80K0@#4<$D,80K0@#<4($LP`80K@$4$p80K@ $< (0K#  @@ @<  x 5 -LM ДA`  0pP 0p(K  ᶔP 0pP  k0 ,0 ^3D@ 'L # ,0 06x,  3oc -LM ごA`  0pP V 3(K0 $Pg  0pP8@0dS,K 6ݍ)[0` S @/+0[0 A RY, [4 00 < 8 YUYp00P P P 4 <0AQ8 xX poc p-LMx@PTp $>0 0`Q! 0$ <P 0ă \ #\ @ 0S@ S Q PT $ph飓UP P .9oc -LM0R pO , 4 P`,  VP- 0`S0S 8 %P 4 P0 0  84000P 0R ,P ,(K Q-L q: -LM<0p @R= 9`R PßP Z`KD PK9@KL \  0P@G2 p B"20 8x@T ^ 0S[ 0CS222܉2̉22Rl20  Rt20 Xvd2l2t2$2,242<2D2L2T2222\2|222222222222222222x 0. 0SP U0S x 0PS@ QQ 0A0_S2lۗx P0@S(K>0D!0<͗4员0变0SPx0P @R帗x 崗x 尗x 嬗x 娗x 꼠F긠D괠B갠@ꬠ>ꨠ<ꤠ:ꠠ8꜠6꘠4ꔠ2ꐠ0ꌠ.Q:::8:T:H:\::::Թ:.9@::,:3::x:p:h:d:H%:t::::::::X:`:l:̐:: Q-L@ _蠮: -LMp`P`& 1PP` 0@00@0@H4| (0|`庠p000 0S 3/P W`` 0(K0S 2W02 : 0@P 3  <`: ᫋:V W`2 z000 Q 1/<0 @R yRz R   pwp30@P0S8p 2  xQ xP Q R 0S ! 0,K >0"0Q_C 202202 202,04@KS!2(022003 S2ձ02ű0 4P spPY 80S 2 81 -. 1Vsb2 `  $ 0X1 -]`Rr0Sn$ B0P 1!02:2B2<2  P 0S:kP 000   뼠 :xAxP8 60 Re⿊P`< : 㫊P` XZ2oc.9.9}22S2S290@-@QP0 2T?\0S 0R00@ -QLp`@0P12^.?\0S( 0R%%@P" 2`X,p`P2 00 0S 3/xP  j/`$ _/ -PQL`0p$2U!2S 0S @ P 0@ P00P00S 0S  -0`L2SpPP@ P00"P00S@PR@-qr@ \^  @@Y@ -L M P`0p6P  P 2 L 0S@ 0S P@(K>0 !0QHP 0 0P)08 <041S,0  p @,0@S 0pS Z I > ӏ Ώ.9oc' p-0PL2`S@2@Spq00r S\ o/80Q 0Q /  0CQ 0-LP@/0h -L@P T, hn0  !  !n -00 LQP`p p@ 000P @pR -3LSP`p p@ 3P@pS0@-qr@P\^  0@00@0@0 p-0LM` Q08`000 2S020 23 0S0 0)03S0 @00h@040TP Hph4 00$POcoc:2:|2::đ:// -RL(M000 `  L0 \pP  #PP D# 000 p 0@T08 <0$@ Y0H D0  08 <040ጎ>0"0H@Qt0@uL  R  pPm  PPe 42 0a0 p 0 @ @ @P P\s0@,0  Y0 040  8 0<0 P 0 8 <040P > 0@,H, P`0@D00P `  p4 0@ P#D p<P80` !(< 0@p#L4P` P`  @0s PH K `P`(KY0P`0P`P`P` N.9 0-0@0@PK@2L  0 0 S :;;S 0S (0@0@0@0cS -L@` PP p# @P p 0 0p00 R0 P0  !40 00pW00  ㅍ0u -L`Pp@P P 0000P0 P0VB000%$00@0P0p P 0-L@P P }>0P0 0-PL@P P  00}.A0 P0Pn0 -LpP`@P P P 00 00G0P0p`0000zPL N -Lpp`P @  0L 0'̠''D;0(T @0pPW@)@  p-L`PM@P P  0, 0f0C P0`<Pp@ 0"200 0p0C0Sr0S 0@ <0= $$R 0A0 0=/ -pL@` PP p @P p  0 0_0C p P0  0#$ 0 pW 4傌 0$ R p=0u -L@` 㩌PP p# @P p" 0 000 R0 P0  0#$ 0 pW 0 $ BQ p<0u -pL@` nPP p @P p  0| 0_0C p P0  03 0 "4 0{pMW  +ͅ0u -@Lp 9P @1 `PP @( h$00 0` S#ꤤ2222@2222d222p2[ 0  00 ;07@ T0#30Ƌ@@\0 @00 30 0  By0 @:0@T00 [0 0030 0 + @T U[0 0030 0 + @T = @\0 @00 30 0  B.0 @:0@T0000[00 0""Ġ " 030 0 + @zTr03 0 "#  0 #200b[0 0030 0 + @WT000L[00 \0#? 0s@E> [0 00 ;0d@6T.0#30 !  000  00\00    0 :0A@ 0u -L@PT  `P e 2@P \ T0 0x10 R0 `0  !40 00XDP@hpf0T00 T"" 0T00 T"" 0T00 T""  0T200 T  0T#20 TT T(0T, $ 0T T T8 T<040 TTT(0T, $ 0T@3T 0PTd0u0S꼪22Ī2Ȫ2̪2/ -Lp P`@P P l 00 P ` C0W0000&4 0`Pe p-ML@`0 PPP0\3 : c 0PKp -L M`S@P VP K /p PP% T%J 0S0a0a010 @ B Q0B RJ 0 @PP0D@T ;J -LMPp@`$@ P   $0K `@@@@P $Q 00  00  ㌉ K -L MP $ 2pL@1㷉`P @+ (K $0K@@@ p@P$ R@ 00$000$ 0S (0S T0 @J K0 @ N -L,M@`,@ poPP @I ,KN 0@@@@ p@P7,\: 4 0 < 8  0K@@@ p@P, R" 00 0<0 ,  08,0 040  ,0 0Q t 0 @(K@݈(0 @ш N -L M@`,@ pPP @( 0K ,0K@@@ p)@P,0S@ ,0 ,   ,0 0 R T0 H@㕈(K0 Z@ N -`LepP> d0( 008,d 040" P T  00 @00 '7<=k ㎈@ $P0 0bQ 00  0  1R03.'88# '40$ 80 i5f  ƃ00Ԕ:9WEV2: 0-DL!88#P!Til@P00 8( 40bS80 000hfoc -LM  0X(س22 -LM) 0K(س22 p-0( LP,@l` R2(2020222(20202ĵ2 0S0C 00 8+0@00 <0 $)a0p\@kph.p0 0 00Cs 0 ph800 $)a0o0K<0phR`0@0$ 8< P@$08<0 -L$M 4 ,000 0@P^4@2] 0, PS 0 t@(0D $@0 0DD08 020@iP@@p0D4D20  Py6 0W*(( (h(%D P`@ W :;0@!0 H008 ,1 p0,l00go G00 <02 (K (KoA0Q 2 0@Q  R0@L0 H@ L@[L0@S<0 8@ T W<@[ 000!!0@0,8P 0 C(Ko0uȴ2 p-DL!88#P!&k`P 0@ 0@0008 ;00< d@sVpphKe0"0@0 jp Cph8eE@Toc 8 8-#TL%`j@P0@ e0pn ujPU n e.0" "2 K_C  2<2oc Q- L Q 0C@000S A  - 88LM#DP$j`P 0@ dp0 ̠jnpP@0T X,@ @@S 2Tp 0, ipP202Q Gnd2T0-.2 Pp W T .>2 02 .6pP2T02P 2p02 .p0 6oc 0-PL@n0n0H2 p-`@`0 S00Ɓ0,( L0LP.2  0\ 0Q000CO@岊4 K (a]00X0phnؠ2.92:H2d2 -LMK 0 K 19 -P L d M@8 &ipP 0@ c@$K 9T ,9T} K0CT 0CT 9T 0S@= c9T '9T Xp9T :cP@$08<0p0 0 -LM8 , 4 0@P_82^ 4  , P0 R 400@t( < $00D08 020@i<Pp0L o820 0 YF 0@Q _  0 U0&!:0 0H008 1 p0,l40Se4 0 00 /4 0001 (K (Ko)49 !;0 0H008 0 p0,l40,e8 2 0@Q  R0S0  ,!P 40O(Ko R 8#8 S  0  0  `2 p-DL!88#P!``P 0@ 0@0008 ;00< 9@Hs Vpph [0200@0@0_p pOph [@%P pc 8 8-#DL$``PP 0@p Z@0d E`Q@0 @@"0 02  i0@ 2<2ITOmdZ@0 .n0@"pc 0- @@L00APSh2022202820 0   p *0@00ITO0  0 0gC 0-PL@d(0d0t2 -LMK 0 K19 -LM0   L{P  0@ D {D (KpP  8PKJu@a0 `80K,K7@K.K-K+`K DuL1@0 `D D\P` 0@@P <` ,H P`@0K 0@ PD` 0@ #D <P` 0@!(#L 4 @ 0@ ! 0 8 <04 1 #000000 N 0-0@@LP0 >0\ 0\fP00hkjP01S01S00hS.9 -L8M0P<0 ,0 00 40 80 pP0){PPp 0@@ z(K80K@K P  @@@PF0@P@0S0S202   0 <00S S 4$0S  S  S  S e S SR0D"P<2 0 0 0KP0@00G EW00U ? Y0 Ppz@ ` S  S '0S@202?0 ,p00 ,W@ ~00 ,T 0 !!g/ p-P0`PL00@8 ,000T08 \p\Lj - 0L 0<,\Lj - 0L 0<,\Lj -Lq@ 8|q 3|贕:: 0-t0L M@P00< ,Q 8| @ P P  0 K0 HK0\Lj̕: -40L M@K I0< 0\K\Lj p-0L@ P|0< 0`\00< ,T 00<0 \ph00< \\Lj -L`P@000TX2X222|T- T. .y9 ˠ00  0< 00 - "X @`PT T .q1à   : p-L M048PK4 ` x 0@0 , (` XP 044 L p4 00 , (` XP Kp||@2@,:\: -L M4000 , 4 00K(0 @0$@  @@ XK2 -1L!M4 080 0@0 P,0<000 P#m/Cb1L#`31C0!A}R?b1L#`31C0!AL`Dzx8 hpW({${\LjqcLpc0A@MbЖ:x2::=j0gN  0O   ! M-- -o00~N01@pdPP > 0d 0T05*JWZ/ вZ,K 00KP`0`0L00x0 R T`t0 \X z, lJxWZ 崽(K HcAj! 00 Q0 ^@ 0 8 0 0 @0P@ `P$ 0 0`(0p,9) 0 0 (0@P `$ R 40 QR PL0L 0 0!!Ѝ XgXg`LjLjLj0 0/`LjLjLj 0-H LP0S 0@  "!@0  "!0Lj P-L 00 $ $+y  %yd:4gD: -P@LP`p+0  "!0 8R  @P 0` p400P Y 0@@ 0 e 0!!y yOcXgl::  -0L@  "!qcgg;:( 3qc p-PL0`04 0\0<@ @0@<@0@ 04,dP,0P @040 \pqc -L004 0\08p@娠L H08`0L`PD0\pc0cpL0 8p0@ 04,gP P0p40 \qc; p-X0`L004 ,@ P Ppqc -LM@0P,aq0P0040 00pP80 040\0 04?0\0 040\0 0@4A0\ 0@804\ 0@<04\ 004@ \|r2:qc$: -Q@4P`L8 Q 0 R 0  5`0 R pph0 T0  4 0T관 0-LhM4@P8 0 0 00c0@ @0qc p-LM0PQ1 6Q* 6CQ @Kp0S 0 Q@ `0K0 0P @0T&b @0S0S @4;qc!1!01!ᖔ!ប!ᰔ!Ḕ00 P/L=jAid0S$0$0h0d///// 0-LPu00@8vDli@Y0h -5pS    0 RL`=*0t0 00bSP1P#U@U084 P00<PET,\U@U PT,0TPU5S𨝈P0T@P,\`,0,6/0t0h -0,@ PL0p@T`9 -L@%P0h -P0@LT,, 0PPp1p!P0,T,@`, P0T,W   4 (0 pGPPT,B0\`i -d@LT $0Sd0d0h0TdTe @P0  -0L@0`PUp000 P p000U ?s /@ Ho0! @0rcrcH: -0LPp0@ 0 ToM P0aT ,0000S{@ 0`Sa084 P00<T,\0@00P0T ,@ P P1P0T@P \`,0 6/ P!0S 1 1PT ,@ P0T@P \`,0 6/|Io00oRlP 0TT0 RPPT \|h: -0L P0p@`= -L@P0hQ/Q/% -LM0@ 0pS40 i ,< 40Xd P0T< ,8 P0 T `@P,8 0 0r03 R8 0dR !@, PP0 T,@, P0T,U  4  (0 0@0PE0P0T@P \`, 06/ 0S ,0SR0  00P0T ,(K@T(Ko|n00P0T@P \`,0 6/ꔙ: 0-0LS@P0 100S0 0hW(On100S00hB긙: 0-P0T,@L,Pt0Q  S 0Q0R00hS000#R00S00h@ -|PD00Ux`LpD0|倀x("@62 @T T 053  @TD00CD0t D00CD0P0T@P \`,0 6/|P0 T,  P0T,500D0"  0C D0 -P0PLT ,P0@T ,P0`T ,00p x0| 0 x0| tP0T \P@0T \PT0 \ -P0TP`@L \p,0 7/PT 0\PPT 0\PT 0\PPT8 \P0TP` \@,0 4/ %hn -pL P2T \P0TP@ \`,0 6/HB0p0l0P @T0\FT R6`P0S- @ U0l p  C00! l p 0067 01P:!+4T\P@A/TL1\ PR`PT 0\P@T0 \P0T@P,\`,<,6/Pl0T0 \P@p0T.3 \P0TP@ \`,0 6/P0T@P \`,0 6/%h -L@P ? Q-L Q5 -@`LP \P bX R PT0X0 -LM@PT0`0F.0PP |Kh8lF>X0h4lPpTX0 p  ,!0P\+  1P`+ 04 0004 80l2pt"tbp0( phHj̙: !d#:`:O5: p-@$1$!@L`0 \00P5 `\10C A85@0 B< \0 0  0?1!58< @0 \08 C83A4 #:0 \p0x0 0-4P0@L8 , 08 \0g -@` Lp\P,; 5/ ,@ \P,; 5/D04S0D0D D @00H@0/Lj@-0QH0/ 0Q( 00S@@0Q 0Q0@0 0CQ@000d0Q<0 @ <0  @H0@0_W@EWDW@AW@ -@PL M`p @H^ WH D0/R 80 0@p0 < KQ -H0LS40ThHP 8s/HP 8t/ 0-@L PR000 @ H0 BS@  (Q 80$ 8 R80 0 0h0H040 0-,0P,0(L@S01 0( R  R d MwD  H00 $ 0Bw 030 B 0C1 25004 -3L,MP|3< 8``RPp XP Hi@(K02,# R07<0 00  (B(\00B0R 8!C8_8 y]000000,0 0   @0,p(08 , ,@P (Q , 8 R 0 RD @8(0 0  D ,04@P (^80 @D 0 P80( @0,0@P, >4 0(#660 @0`A0< 0Q 0 W. W, 0 <0 b# 0  0  00 4  00 0 00`4,X$V D0D 0SD0PDP @00@0J< 0 ? R< X b@  \D0'R0@QOcLjp9|:sc -LM\  p_PP ` ( `P  (08@<0TP< 000 @`0`Oc -0L@P`!!,  BR0J3(J38I3 J38I38I38I3J3s ,40 \,0\S4040 0,1@T0 -0LMp3 - 0LpP3   0T@D 0 TP $40 T` $80 T $< T0  $0 "$ -L$M0pS !Sr S S (KS S S000Sh0 P @ 'Th0 h @>$10l 0S 0< #30 0R:l@TP ml0 X `lP @_1C`V @l0 Y  `0lP@J1C` V@0@,\ Jd@0Sl@T 0s @l@d Pl 0 0l00 l0l00l h0l$!l0h 0$1l@`0S]h@h@P`@@TK PD h0P0h!00 1P`U40S1hP@F?D@hP@H=D@0SPdPH 0?`S@@C \ }0P6 d\ H0 DJH0X0l TH  l0X`d 0L , `P@@T 54 { sT@H\ Jd@` VLgL  0SUH 000000@H 0 00H0 0H0 L 0S2H 0=0@00@H000 H 0<0 02H3L`  0Sg Rg @R  00HS80]`02 @0 0!D <0 hG/000H 80S0,0 P`@HD@<D0PhG/000@Q@ @ % Q @ R @0S P`@HD@@@<0S<0D0% S <P <Q P`@HD@v< DH,80S, FDPD< P DQ D RoXPR@LtH080?@9H DD<@P/@)H0DDD@@@L t 0SqH 0<0<0H 0;0H0;0H 0T0V PPL0S0S0SH00000@H 000 H000H 0000H00/d P@lI 00l 00l0Pl00l Ph0l$!l0h0$1l l@4hG/00000HS 0STH 008 4 00 $0PR P8Qd Q& @Qs00 0 0 0H00 R'4 P]@WD@NPH`B@<HD@L@0P*`$@HD@L@@ D@@H0DCP@lP@+H@DH 080@DH0D<@D0@0n@D@yD7S19p: -LM `dR8QI 9L< ]RD ZRP1=@0(S@ U'NR0PS@FR> 0 ?RXX  8R0 Sꬣ3333|3ܣ3У3ģ33333p3< |#Rt Rp  R`V.TRPR 0S780SNTQj$R0lorux {@~    QX`V 0  Q0S S QpQ 0S hQ 0S@PD\ 0<#0C 4Q 0PS@80S Q80SPp<@D@Ÿ^0" T0C@Q80pS PTQ QpQ0 Q0 xQ0 hQ0 XQ0 HQ0  8}Q0@ (xQ0} sQ0 z nQ0 w iQ0 t dQ0 q _QT]QX`VoXU? R6(KOQ-LQ*IQ'FQ$|CQ!t@Ql=Qd:Q\7QT4QL1QD.Q <+Q 4(Q,%Q1 0@PXQU (KoQ<0S SQ Qꈝ:ԝ:::2:R:0:: ::d:::8:|:::̦::ğ:П:ԟ:::::$:0:8:@:L:X:d:p:|::l:`:0:P:D::::|:Ԟ:Ȟ::p::::: -LM0 4HPK4 8" 0 P @(KTK0 KP ;PH D0T `pP L `0 \ 2   hK6` S03h0 5* 8423/PT00T  P(W` "RzT0K0K0 P;TT  0!"  `0  vPh 0 pP X0K0K0  0P\   0T  `0 \ UPh T NPd T GCPT AIPT ;SPTd0p00T0 "RV11(K0!R!TK !00K P; UQ0U PX2QL PJ ,0S<2 RUXX P X@ T@ T0X1V/0\!,0  YP d E@P d C00\ 8pP \ BX0X p \1P@01 U\! P1s@P cDPDP \DP;N,p1=@0S@ W/N0pS@'N\ @P \ B0X0 X0 @0f@N10@p NW\2939`ucȠ::2:: -LPp`@3 $@ T`Vp @3 $@T3 $PP0033 p-L,M38`K @004 P MPKp3 0K40 K0 ` 0PP84 3T38 #40 4T3  400 3 400MP:4: -L,M@QP` 3@pK 400 P mM@ K3 $0K40(K0p 0P@ UM@@$ 0 <$@T3( @400 3 400X:|: 0-QLM@ Q Q 09P@YQ S00L @ޘ9 60ə9@0Q9l*" 0-3Ls@P x8PP 03 400 400= 4000 p-@L`Q PU P 1S BP 0$@T$ F? R 0S|0 R 0S0 RT p0 BP0 Rp39?9 -LM` P#0@TS X@T 0S0 S {LX@TpvL03(K0 0 S0 =~400pPÕÅÅ ?00 P PL3 400%- P υ0P x6Lh1L υ0z@P <%L3 400 LWZC XZ Y* 0R WZ$@F? R 0St Q X P 1S BPO  0R 0R 0  P6(2("3$2# "32#"30#3Õ 0T3 $PPT 30CSC0!R0S K R:P2 3 400y0 AP0 RT Q. KPu}0 R 0SK.Kxd0 3#0 3#0 3#3 $pP0 3#x0x 3#ꠡ:x:ȡ::: :<:39\ x T L Ȫ l*"p:L: ħ Ȩ  L3"/"0"2" p-LM`5Ps`@ Q Q Q ph$$h@Q l0h5lpl@ll( 0Ehph$t 0-`5Ls@P' lPP#P |l5` 400l%S 400dq l5 400l% 4000 -`Lp0S 0`V! R R 0S@P0!SP@ 00!R @P UX `4zczc -LMp `l%0PU/XPU, 00CS0  0SQ400C \1@@0C@D0C@̌0CR2 d ,0X 1@1 0R4 h 0X 0@oPP  0P0H I1P ,00 0| 40@\Hp': :<:`'d'0:\'  L$Љ ($::t: ;l'T: 0-@LP0!R 0S >P 0 !R 0S >P |0@TGD@T T \ 0 SQ 0SP00P0?9`D9/ -L*0 -0L // -@$0L $0/ -0L -0L@P @00  h0( Q0 ,0 \00 0-L΂M0P @n n @0>2Q0 Q DH0 0  P0 00괩: p-0L`P00 ,@0 \phGЩ: -L$0@P 0hy0h -L$0@ i 0-LP@T  09| 0t S0C1/$ 00P0#S@T @ @<d:;: p-LM$0P@P `)@K\ 0zF0H ]P 00P,  $FKph :3t9)::_ -L M0pSl!@ `F00 0P ,F(K0S00 \QJ1"000`p2A@P0@@$(P@03/à, < 0<K 8 4@ 0P # RO L0 0704X(`FZܛ9:@::h:<3{cD33|3 0- PL$0$00- $0$0  $0  $0x@$0P@}0H0T0$0$  N'. -LM@P`p ;0 ` p0@@ 0 0-P@L ; 00000 P/L=jAi / -40LS03/ -80LS03/ 0-L<@@T0 \6/804 H0L 0X0@ <0 @ D0`:;: p-LP@Z`T 0T@Tʢ?T Q LBp|pQ Tsp&+L: p-@L'P0hp 0-LMPd@P 0 -LH@ \P`p 0piPꧨ? D9|{c -LMpppP@@X X0`@HH00K< 0@ , ( $P ` "Koc2:|{cD9`D9hD9U4////@0Q 1CQ/-1CQ00/00/ W@/ 0-@LbP_PUPP 0$0 R 0000OcDNj Q-L Q 0-L@4PP P0S0   0 0@0S tt3P h 0S 000@H&P@ 00000P g0|clE9l%cxE9DNjg -PL<Q` `40A`t G<Q <QB@41s* qA 8\``00!r P P0S Q0S880L  8`\ <@QQ `40A`t <Q8\ @00@p 8\L ]0ST00P0Q!00< S9p쀟@ 0 S RL0| `Rp H 0S l0VSpt@ `<8 @SW `0T"1H a$ mA x(H TTNj\E9;Mb -TP@0Lpl0p`t/(t r 0l0 p00PNj' -L -2LM1 00_040< 4!a0 @4``0P4 84l`Q@ `< 80H < LR @400@p < R8\p`p00A`t  18\ 0 0 00 00S@,0 0$0 (@ P >>,Kl 01 x\TK8@H (0,0 PNj E9,E9p333L3oc(|c|c2:43|c,0 R 0s3/0S/ Gj -L0@$ 4(001 p-L0P8@4 #h(@T008# T08#004 Xp 0-PL0S0 0S0@ 004(, 0 @04(,004(0X004 0XP|c 0-PL R0@T 004$ (000$ 4X R00@T0004$ (0`004$ X004$ (0 084#8$ X0P|c -x@LQ 0 R 043$ XQ0 R034$ XP|c Q0-L@ Q 00S0<00PUU< ҿ0 04p\0@4 0\5pn_004 \004 , 004 , 004 ,@J 9@|c: P-L P P 08hh褬: 0-t0L @n04 L0\0P 04\00500h|c Q-L -LHM044@ 0P h88hLpcpAĬ:2:/D0  0S S S 0 S/|c 0-0L  0S%P0  ^ ^0 PS n @B21n@P0(0e/"b0 0|cQ0 0`/|cQ - L0S0@T L0 T,T 88S 0Y?8h8L#8~4T6 \8sc@B -@Lp᫾`P@PUPV0P0 h -sLp3 -@LW`h -0LS@ PPP0lPe0P 0Pt: Q-LA -LM@31C04`Kq@$PK4 PT T4 1S R$ B1S R* P\1 R 0!@ KVUUU  -L` Z>0PS @@[UpWPPU T1 dP R@ GUpWPPU@堠TFPX#0S9 0@S0p堠0W  P0Ӥ0 P00 o2P@QP 0S T  뽺00 0S0 S@00@@PW QT00E<0h40Ba dpG9:;gfff p-L`aP`@P@U@QT c@Hpj@D_Pd T:@嶺p -0L @P /p0`00:00l:0P 9@@O|vh8scgOc p-PL`z#`h @ 0 0@ph^ p-@LP0`S 0S 00p3p00 -L -L 0-LM@s9e6Z3 0s0 Z0 X0\ 0 P`0d h P P c\])@0@ @ <0K0:4:4,444T 4 4g(^3T3g/>P//A-tR M@`T`2`"?Cl2<Ÿ1C 0 ЍR2r 2OD 1C0@l21C@ P1B00c"!B0cP0`0 \0d!S0SL?C  ba"!BA00?000B00c"!B 0cP0`0 \0 S0SL?C  ab"A!B 00?00w0}cgVUUUpNj1p@-Q= 1CQ x1Q p00p@T)^&Q# R `VPU1T^QRT Q V U 0SS0SSph  l00p  t0 0x  |00  d00ph@ l 0p0 t 0x0 | 00 d %W A W@ 0-PL㘾P 㔾P@0dP0h0 -L@Pp`{P wPTU @ p-L`㘾 PPPUp     @ T 0 dᔆ 0PPPUp: -L M@PPK ֺ` P+H101(pKaP VU3T0\ `S( $  PX!$ X(!X%( $0TP`0\ (pK~PH忽 00!00 cCa0 "ʻU d0SlhQ tpp`W (0| 0``$0 0f( f$ <00S PPU;QMb0}cTNj 0-LPV@p0h菻 Q0-L@P Q 0L0S 0P00DH_0 㲽0L0S  㪽HOHG0P00 -@L0#0P0L0 0-LMLP@U K00 ㅽHP % 0P0T L0  0/HT4 0-LM P@0WRMHD0D0 P G3h 0'K$ 0XK0l4|G92:|c4R 0S p 0P /p/0 P/ p-L M8`K@P 'T080K@ 002K2K0 K1 K\08,0 P D22[2[   2Kp20u:@: : p-L M8!@0PSKp8`K t'@3@  U002K2K0K1K8 KX08,0 P @22[2[  220ud::: -L`8P P@ PTf30pW  P ,0'('( 6H)@00;00000Evv8!00:Bܭ: -LEM$PP`81 ,8 8# * pP 8141 0 S0 (@jP< w$0ąQgi 0", 9P<,@`  0O 0 @TPM $" \04!0 ,1Ss0@< 0@P`ȡP `0,A@#T@!Qa ?8#808#8?@ ?8#808#8?08( 8$ 10q& P P (1ST!4!4!4!4!4S(K222,!0 d,! R(0!8.0OP`8 0(1KJOK,8  K80 KDP tY-0   ! 08 Ƞ,ȠD0K ?> K80 K+P t@-t<-0 0 p_DCHS%@ P'-ah ;p:x::`:+4 ::0:X:FBȯ:8 00000S0C00/000/ 000/ 0003 4 0  <040// 0 8#8@08#80/ p-L `@PKm0 8#808#800 0 B4 p8ph p-0L @` P 0(0s08#808#80 8ph5K: -L$M# 200l1 0(~U 0 ~ 0 ,0   00S00(^~0v P`%%<40!@0P8 40 0P 0@ 0O0 @ $ 0 5P%P0@0,D HP P0@000 Y 01@0 @( \$pڰ0c 0 9P)P o@  3P08#8= Ƞ,Ƞ @00 >0   t3P<P 0<$ m0,0 V` P,@}00000 }0@P}0040 } 8 {4@@0@  80 PA "!,0 0,0D0 PP0 PPn0S0F 0 4P$P @  23P,0Q08#844@@0@ 80 P,04 0,0T 0$00\ h 03@T@G+<.P000 (Kor0 0P PB Ƞ,Ƞ @00 ,0 D L,0T D L÷  (Ko!  0d@ +\+0 400 (Ko6 003@ <4ȯ8::::ܰ: -RLM0  `3#40 4 , 4 B B 00i$1P, 4?4D>4>4?4?4@ ,0P00  \00!# 0J 4009   000,00,0\@ ,0TP00  \00!^;  0  000@ ,0/P00  \00!08#80 40 B @,8#8  y000v4 00i10 > 0(K@,0 PHŸR00 x00! $Ÿ0 &*00 b !*0004 00i10 > K@ ,0P(00 00! 00 3@ 8^4 0    E$*\0 R 0  0)4p 00i10 0 >p0400:@3)3 0004 \XPH~40,ȯPB4:̱:ܱ::d:::::: -LMp 200l>@ TP 04 @`=Up20 9P( 00  ]0@6 0T R P0000r P 0 Z)000U@ 0@D)0@000r$KP 0  00 00+)000\000S0$ P` 0 0@  0@$ 000$ bQڰ0N\{P000  0 @()ȯ:t:@:::$: 0- L0P@K0h"ȯ p-PL@8`Pp00 00000 0 (0 S0$0@00 @ ,00( ,0 ,0$ $00 40\0pDE4PB4 54 -LMP \`Qp @p @T V4 0`D @2(T(  ((}ch}c:X9:: - 0L00S@ 00S 00 00S00 0ą*0 0  -L M<`Kp@ P0<0K0 60K@?4 K7@KSK00 5 KP3[8#8 K -L M@pK0@ `0  @ 09 K!@0K080K4  #PP 0l3K0P ,` P@ " K ^0@0K18 K40 9 K3[8#8} " s09 S" 6 04"40(Q(A 04"40Q. 04"40P"3(( SS" 'NEFX/ -LD 0 h\:Oc 0-LMP@T |')eswd0d`0a#0L 0K8P@$0$j'}c̳:;XNjQ: oc: -L M0(PK@%@(p(}D@0 `P@ V 00;00my0  (K( 0@K0 $ 0z P0P@P( 00K$ 0zH0e/0 ,0 0090008/Bx@g -LMPp@P 0  (|0D `p@P V 00;00y$0   ݍ@g 00s/S 0S // -$0L\0}c - 88Ld#0\  10<P\l020 }c+c - 88Ld#0\  10<P\l020  }c+c -LM0@400 -L Ƞ ȠX,^   <P 40}c0$ (0 / P-Lp` 00PUR,@l020@T+c -LMpZ0  PU S00 ,0K`P @p@l0, 20, @m p0#((0"40100!R: 0S S410<`V/ @T' t!20#0 0pP$  Pt0t0 l0PX 0 !,0 !, 00 0?P0 H 0K<0 8t}c[4hO4+c+ -LMl@Ph`p"0 0 0(0S0  00Nj:Njd?j~c 0-@LQP l0 200Qx x0 S00 S P <0 S  \0 0h+cncZc$c4 -p LRQ  0$Qh -pQLP 0S0@0S` 0A P` 0S@ -LM@P @K K 0   K Q-PLp`𭝈1<@T 0R$ 0  `㽦p0S0p0< 00@400 @   |Njl: -t0`SLpP@<0 S P@ P UP \0S h~ -LMp,  `ᱹPP) W) ᧹@P: 0 S 0/ xP ) 0 0 P P `y8,00(K0h@00P d8,00 . *Nj - QL M`Pp1< Rp8@P" 00K4 K40 0( K,0KpP $K(04@KP  @t@P400( p<@ޥp0S 04p0 0p@l` -@ LMTPp` 1Ta !1T` 1T @1TP 51TC 0T\@   00 @ 1CT$ X1T00 R ($ W ˸ 8D@P.  ㄸ0T i0Q@P 0s0S ii000S 43/@84 00@P `WUW$NW; S V \P\ 0l@L00Ta @XP ;D; S"  0 @0E8 U:S00P 2UP 30E8S0E8#X8UP 00Q1n08#XQh0Sd00 @0 0U~ y0 00 00 00 00 00 @00 00 <0 <UD 0 ;\P  40 9 PUV ;a  `=0SL00 RLP SBl0V ;   0`(0Q 0Q!0S  p-0LM R3 00S 0S, @P`0S0C00  0AoQ*0 R>;  S0S0C00K K 4O 0 Kpgg~cg gPH 0P 0Q `0SX0S / /(~c -00 0LS@ \ @g -|0LS@PQ \`V p\`Vp 0U\0 pP\P\`U  T N:: Q-L D4:,0 (("1XP /(~c-00 Ƞ Ƞ,1XP (~c -LM\P`  &4\ V|40S @ d4\$ 9X4\x aL4\ D4\ <4\ t  0p@3\ 3\ 3\ 3\P< Sl$0< S<1S`P @d3\6  0C\ 0\} X3\PV@ 0C\,3\ 0 3\ 3\ 0R 1  i2>2\ 0\J 2\20S20S 3/@ 0@0 0C\0 0 0t  0p@t  0㷲0p!0 l=@PK  `  0@0  S@PpM0@     00 @l @$010:t 0@       00 "㾶@P   l$!l 0@PlW W W W @W@W @W WWW WW@W @NjNj`~cWP~c -LM\ 0\ 0\ XP* 41 P0\ 0pXQ 00S00XP 41 r 0, Q}f~fvt|f 0-LMP@@0@0CS000@- @.@(~c -`0L Ƞ Ƞ,A0S040000CS0(~c 0-0 (("ALXPU 0 X0 M`0S 0 0 Pa X P 4(~c@: - (L(" PP$0AT PP 0SP `0S d X`VP 4p0H0PP X`P(~c p-X@LT`p0 ! PaU  " 10`P$0S 0Sp04 ph, phl0030Spd: p-0LS@P`'0S  lVPPp\P l0 $0|QpPph UpQp0P`0ph00 0-@LPQ 0S \P l0 $KQ0h= n p-`0LSP 0SH|0Sl1  X@T% 0S" ݜ0`0CS0000 R00$0S80S/0 31C ~P! į0Q&ڬ 0 S00 S P0 [p00P04 T00mg;:ncZc4:,0 -@@ @$@@LG0@ gg -T@PL p `Dz $ $$ p%0 @gPv4 4u4g -T2 00| 0PL@P U[ 0SS l cl0@ 0p l0 0Ct x0$PUGp`l0$ R3 X1 M P-  lE Pl  0^Pl0$10S+ pX P/# Pm & (,l   X  Pl  Plp`d0d@B\Q D: 45l~c: gx4:P~c`~c2::g:ص::0Q 0`c/  <8S@08#/<@8oS/: S/>; S/P/ 00S/G9 -L@Q 44@4d4ܔ4000000<000000000000000000 -<00000@ L!pW`V0S \ P0 UD*\? 0@ b0S0@000S0@00 h40\ $0( 0b0 0, 0b 00$0< 0(0,0/@0S/ \0@0/0\@ /DT0 0/X0\` 0  ` X0\/ -LM@  0 P ?!?CP  00 0 0P ?"?CPG- 40 00Kp$0 p 0x !!! 0 !!!d0tPS4`K_0SYt Q|0S$0S'0S* 0S- st08t0 0 S|     K0(00|0t Spp 0S  0S  0S 0S$ 40 44 0S0S 0Gt 2X04 0p4 4 PH 0P 0Q `0SX0S / /ᔁc,0 (("1XP /ᔁc-00 Ƞ Ƞ,1XP 䔁c -`0L Ƞ Ƞ,A41S01X001010CS01蔁c 0-0 (L("AQXP U 0X0l p;`0S 0 0 POFP " ꔁc@: 0-0@l0LptXT0 00 PU0'P   0h  꼁c:2:: - (L(" PP$0AT 4PP 0SP `0S ,X`VP 4p0H0PP X`Pꔁc -LM0pS8 `V R ʯ4 0Z,0 Z8@P,iP:"0 0` 00a",0 WP*P U@4 @4 0C!1R000 T4 Q  R1X10 0 \400 SZ8@P U@ 0PS0P  J0Y  U @,4 0 RP@ `u   P, PP:08"S @  0, PP*(K,P:Z8R@ 0 0a00a" ^  1 0C`, P*@4 f(Q0A S Q Q Q/1S 101/t< \t0t000t0t0/ 1!S00 1/ķ: -PLPp`$t 10#0V0#SP V  Ot t  T @T1"@0#"@7t @@t 10bc  dP t0@00 0-L LRP001@0 "L@P t@P@0 p-`0LSP X@T% 0S" 01`0CS01000 R00&0S10S(0 31C P 0Q#ڜ 0 S00 S P0 nztpL% 04 j00;:ncZcд4:/ 0-p@LTPX000d@T0 -L -p@LT0 0X0d@T -@X@L 0-PPL@0 d `Pt0dh0t @\ tR 000S 3/PXQ 00P0d 0R`0h0h0h0t0d h0 0 0-`PL\0@S 000S 3/d Rh0h0h0t0d h0 ` 0X0S 00 -LMp@Tp` P0\ 0 De@P ,0 A$  @cc9H:$: -L@P`0SX0S T Q0Q `0Sh -PLMUp:`3U)7 P3U* 5D3UC 0U 0CU X0S\0S$ p@T `0 0 d@P`TV 2U 2UXP5 41 P d2U *0CU0S S` SmtXQ 00S00pP dP 00 R 0RK1U 1UpP \ 00  00dPXPU ``/",000bS XP 41 r 0, ^m$ 2  @0V@@0@w0S0Sem04 00aWbWvt}f`WcW@- @.@ c  - L@pPP0S`0S X`V4@q0H0HP0/c 0-PPL 0S L0Q0@P0 P000c@-@Q0A 0 #3SS  S9 @S S FP *204SS S1 S / Q  Q:@0CSL444d4\4T4 Qj H QJ  QP j1P 0PIPN 1P Q  QP 4P P@@ Q  Q?@0CS񟗵44444444444444444|4L44t44l4 Q  Q P*001SS P~ P{*X001SSv u@0Pq 0Pm .0CPihH9xI9H9^I- $   (00 $ ,00%0CS%844444444444H444444444444x44444440< 1,0p< 8/< 0,10< 8p/8/0< 1,0< 8p/0< 10< 105S0< 1,0p< 8/080/0S \00    080/ 0R *00 S0 0Ô00$S  8/9R Q  00 B00  8 /;R0 080/0tS0S0C 0  080/080/ p-LM0P30CS4444d44 d( 01bS<00<08p0S ` R@ @00 E0 @R0`S0d (0$0`0S d0Sa 0 @ @0$0#0 0@T:D $ 0l `$ 00 ( d0`0S dQ2 00@SJ0`C0$0 0 @T`FZ 00S `@D0$0 0 0`V@:` $0 ( 010CR d(0r ( o ( k 0- L!0B@S44h44h44h4h4h4h4h4h4h4h4h44444444444h44h4h444P0 S0 0Ô08PP0 d (0812cS<00<00 Q00 B00  000 0 \S 0-L@80 080 -0L6S@ 8 -0L%0C@5S844444444444444444444444444444444444444444444 4444444444  8  0< 10,p<  -@\, `0L<0Y0CPD L0X8@ HPT  0S \0 Q0 t00 |l0 p xh  -LMP@`p00 pt 4 $0 000 00PT0p0\0`0d00000(K000 0Nj-X0T $0nQ 0 R$ 5` R $0 R0d0 0( 0CR0d0( -LM 0A^Sx4h4h44h44h4h4h4h4h4h4h4`4`4`4h4h4h4h4h4h4h44|4h4h4h4h444h4h4h4h4h444h4h4P4h4h4h4h4444x4h4h4h4h4h4h4h4h4h4h4<4h4(4(4(4h4h4h44h4h4h4h4h4h4h4h4h4h444h4h4h4h4h4h4h4h4h4h4h4h4t4L4$40(0 , m,p (d0:3iS<00<0W8\P ( 00p (<0  0@ @ppؐ$0L P1 DHp@tPx`|0hl ( (p (p< p (,0< l0< p (,0< l0< p (,0< l0< p (,0< h0< p (,0< h0, , pP, $p(p ( pz@@( , ,p (@@k@@( , y,p ( ^< p (,0< 0T< p (,0< 0J$T00cSf` 0AR$0Z 0SW (0 CYpp0d0( / ((0Ap0( ( p#<0p (0<0<0p (0<0<0$ L<<0 x0H (|@P@DpPt`p 1h l0  @P` 0ؐ (,0Ap0 (p0 (pd0,  p-0@0CLS8444@4@4@4l444L4L4L4L4L4L4L4L4|4L4|4480 S 4( d>,0`SpPBQ *0S  0 SQ:(( d>b$>.D $ 0 (0Dd $02  -LM@P`p 0@000 P 0@@` 0@@` 0@ 00@p@`00 0 Q Q Q/!R<00<0 ,R<0<00<0// 0-AL@<0)Q9 44444`444444444444444444444444444444444444@4!R@P ,R @PU (0@$ 0<00!R0 ,R0<00!R0 ,R0<00!R0 ,R0<00!R 0 ,R 0<00 -0LS@S 00\P  ^ :!0000C9Q^0/Q\\0 0 C^\\0 0 C00 p-QLMP@J Q: Q `P $ 0S0d0p 0( 0CR0d0(pd( 0D3>b$>.$00a`CV D0`P $0 9 D0`P  +$\(0D d0 1 `P $ R  D0$ -X `Q`ppPgUL@T 0D0T `0S UT `0T ` R $0 R0d0 0( 0CR0d0( -@X`Q`ppPgULT 0T D0`\ UT N`T ` R $0 R0d0 0( 0CR0d0( -L$M0Q 8  4 gRP ڀ;R /t;R: h;R `;R X;R JR APR oKR& MRT`X@0$S 0 `fS0!aL\XT xX@T` KnR3 ڸ:R <R rR0S 0S0!R CRllQ<0 0 0X$0( TBR GDR HR<@_ T0RX 0CR00$0` RN $0 RJ ( 00CRd(0d0 >3R R !B0<0(cR fR XRd( 0.@Ro ARi $0TR a`R !0bP$0V 0SS 0( 00CRd(0o8RI 8R 8RE4t e`lR ;hR:0S@`5ژ! ^0`S@K0S@`$0@SAژ! `P` 9TX0 $0R0`` 0CR00Q$0 0S d"4h !d 0 3<(R nR`1`!@ dR ,$ <, d(D0$0,<7 @T4 ( d02!`S0 BS(0( S<0S0!c@<@(00CS񟗡x44444444444444444444444 4 4p <0($ T0$  c<`K04%p  P 1 #44 z\QV R(0 p/l0SH4 h\0S$ ^! p@\00<`KSX$ TğWP4 0@]p  P 1 #4G p^0 @4 <77 W30S@` 0@S)ژ, HP` !H`PLPpA 01S7444444444444444444444444444444444444444|4p4p4p4p4p4p4p4p44`40@S `pQ $K 0(@K@P$0( Pp@0D H`LX`p`(pCW``C````````0S@`Âژ, 0`S@d ><(@R dR`1`!p gR ,$ <, d>,fD0$0,<r d0 S0S0!0C$0RB ]W0, DL P0@H0Ow$K?l?p$?h?p!c>J?u&::ĸ::::ظ:и::\9:9: -0LSP`! Q"@𨝈0! 0@T2D 1C@p`@D 0! @00T J9@K9 p-0LS@P 0! 0PU0S`P 0  0P U0SH`P 0  0P UphpK9pL9("Ƞ,L(oR- :  S >;  S F/ <0 < <8SL$ 10;C  3=8S$ 10  >08S# 10  <  >8 S # 10   3\ ~0C\ 0C\ h0C\a 0\- #0%2$` t`0 V@P -@SL  A0F10g#m8 - R0L00@ DH10C1 !: h5 -LM@p `ePP  H D0ߍP   0P000 00@@1 0s030  \ HD0  !1A/0S1PQ 101H0D Q   0 0 HD  S p-`P LR 0S0S RMp@p  00@p00p0c 0-@L0PS 0\ 0cS0?000P -`L @}yP 00CS,pX `00 T008@$ Z 0 00<T808@<0  S<D h@0S@8 m DH$<DD1c!@0LP ($ 1X0$ \0$(0T @0`d0h0 @0 1c< 0@b001"P` DhDDd c,2,"0(2 $"0 2 "02 "0Q0 0I,0F1 0 0A S$ 5555 555555555 rDD$<nDH,0 |,pzt,p  00!0 (1(!0 1 !0 < ,0y0 0 `  `<P @@ 004  b<@P `0 <" `|  ,p p,pR<L5P55t555555\5 50 5 5p 55x: -LMP@Up`}0 S^ 0 0Sa,0 [ 0 P 00a PPJ,0 pkQ,10!48<Q@qN ' 0S$ 1!01 !01 , K0 0 7/HD0R   0, 0 HD  S F[K  0 K) 0P ʨ`\,K K$ K(0KP 0h 1 `0` 0 X0X 0 P0P 0 H0H 0 555D5l5 5:Ⱥ: 55 55L555p55@-A0S 1 00!#1  1""00#$48$0,0c80\DL 1  00 ! #1  0""00#$48$0,0c80\L 0 00| |#1  h0h""00#$48$0,0c80 \00=4Q *@$?4S0>48$P0R 0>4=4@4?4B4A4D0\0X0 0$0(0,0004080<0@0 0R` Pm p 10W,0  WI;5;5p;5;5:5p`P@HD@ ,0S 5*0JS=5=5|=50=5<5@,0`S Z 񟗶>5>5>5>5>5?5 ?5?5 ?5?50@5?5j!a 0R@S Z 񟗓>5=5<>5`>5h>5p>5:5x>5>5>5>5H@Dt@0,0 10,"A @,10,#RA4>>0 0@4A$A4JL 0RP0 0BL00 h (K0P0T4T \04X00=4( Q0=4ȅ0=ȕ\0!L0 0P HL0,$0  h a0P0T0P0TB4W0B4 0$B4S!??Q/$ (0R+10,"( ,#?#B4W0B4 0(,048<@DW 0?$,?R10 ,?$ȕ,0B480 004P ^0W ! 0^P RN \P0M ! 0PF RD \0`0044<40C R<$21C01 dA`@0 0 4Ĉ!l@d <400S<4@ h 04X04\<$21C01 0z10` !10!` n h 0`\X #`0 @-@\pP  \ `1 `#01^0P5@10L\!N013 fW00S300P/ U p-P`L@ 凃@8d0PpD -LhM ` PpK@P <0S SZp0S D0Sl@P$K -LlMp0 t 0  `KP@P @0S<p0St0 SZ80KYZ@Y @(K -LhMp Pp@`KP p0S<0SW,p,4 00*qPcg0P$K`1S`/-T1S0T0 R \ 0S0S  QD(K0 0F?C, D \\ P \ 0S 0 S  QD( K00F?CD \ D1S BT\1S m`DP ]K0 \  D@To(KK D_W - 1LSPp @`1" j 1 S`@ !b1S 2S i/_ Yi& 0-a1LS@P \P PP  㗀0X 0 X:Oj 0-DPLMXa@ $K 0$ P  ?\K0蔡c4 -@L`pPP @V0, Xb10Ya1P u :OjK5/H 88 #Q 01S 00="R//ἡc/ p-<2LS 00pdBP `>o0S ph%o000 0@@0n -LP 0@R01S0 10<P 輡c 0-Lt 0@R001S00 10<P0 PP0  0h꼡cD 0R/0!R/00 10<P/ 꼡c Q-L (t: 0-0L@0l0PS * R% 000 00S0 rS 00S0 0hm R <0 R 0  0 PjOjPj 0-0LS@0gl0PS 0  0S0hmꀻ: 0-L@P0h p-LHl`P@T" @T" R0000 0     om +l0P0S0@T]m%~0  խPgOj: p-Ll`P@T @T' R0000 0 0000>P 00S0̬@T'm}#m kP(@T0  咭LgPjPj: p-L@PP 0Spk0`  R l05*  @@ 00P0R 4刬phl$僬R00PjLgPgOjPj0QD@2/P 00 0-@0P@2L0@20 =R00800P8008P0 0-0 L80PS \ 0CQ 0 dP g0 0d20 0 @42СcPgLg -L M0P=2S @2* `2ST1 R8Pi$K0K⋰0`Kl0(t `VpQ:J0P18 ϠT?D3c0Sc 0P@2 0=2@P n 0@00 @20@20 @2 `2S 0 @20@28 T0, 0S0C00=@`p PjMb -LlMPğ @.`0 =rW@ 4Q 4Q{ 4QI 4Qd @(K3Q 1Q 0B~S1 0< RO L@K3 p`0 \` XpKTp 00lPK80081 PU 00 00K0 @0^!0 @ 0 K p0 , | xp tp 妢 @} 0B~S1 0< R 2@0 4p q<` 8pK00L@K80081S@ 0B~S1 0<P . i@  @ ^ ^ 2^|  Zy*Rw 0< R Z@P 0@00 0Pd0 `@ 00K l P0 hP T , \ Xp h}T0PS0@E 0 8D<#8 P@ 0Z 1!Q T0Sl K@U4  }/ό@* 0B~S%1 0< R 0@0 4p p<` 8pK00L@K8 008h0S @ l K@P0꼡cUUUUU@N5O5 O5 -DL< <0{P, ,,0{P Q5c:cR5:Ȼ:: 0-LM@0L04 PP@@ T0S008  K000 =2:: Q-L@ Q h螼008 R 0 0=20<20<2P 0 <20C<2008 -HrL`PVq 0}/000DR00#`B 2 @DT^5^5^5]50 0=20L0ap0S0 <20<20 @20@210@ h \0`Pdp00 ed00d"RJ qP%00 S8=2Sl`00`"R!000008id0L00L0 0  T00S 0<20C<20 =2S|0| ||@x0t @```zxPA00=rСcc0:D:2:OcU5PjOj$:LgOjPjPjPg[5X:0S/0="R/00/ 00 0/\/40  /40/@-00 00D Ƞ00@,Ƞ  4@ 0D@ 0-L  Ƞ ,Ƞ000  P P@% ~D04P0D00@-` V @P x  00Q@ 0 0D4`q0  D0PQ0-0R00\00^00L//8/0 R2 1C/ -,0L0S3/L0S/0S40"00/- 04 P#*0 \*0S \0S /P/ - L00 -Q  <2<200C<2<2 L<2S00-0^  0S 0S  ^ 0@- 8 ȠPQ@#,Ƞ R 0 S0^ ^0R0 -L@b 04 p-PQL`@p`U 000ESQp 000 0ASQ0p - 0SL *@T 0S04P ::: -@LP ,0P 0 0:僮ԡc 0-@LP"g0H0 @ H0P00@ 0@Rh0 0-@L gP0 P$0  ,0P0 00h7hD08 00D0< -D0L0@ 80 00 p-P@L00 0K K`K`K 0`K0K`K`K)P  K0Kp -L M8@#hPP @pP@ 0Č.0 TP$Y0@0P *(K`} 02K*K2K1PK0PK/PK.PK-PK,`K+PK` `P~P*0[  @01K `2`K0K/K.K-K,K+Kd -LM@0K p-LM0@SP Kp `PPV e w0  K 0K0 B0K K 0 KPKPKK0KP 0-LM@P0  K0KKK0 KKKKKK0 p- 0LS@p,` P 31C  = 0Sp;T: p-LM@`^P 0S 0S 0S 0S P Kp  0SK0P 0R 0 00  @00 -LMp 0K`P@P KPP@   0` @z 0 P 0$  0P`0 @ 0$@@  -LM }Ԥ -40L 3$ 1C@ᨥPhZ;\:d: -0LM@ 0K0KK0K@K@K@K@K@KK p-LM~@ATCd KK KKKPK`K@K0KKp p-L@MPAd K!  K KK0K`KPK@K@KKp -L@MpBTAd#0 $K$0K#K!PK`K"K pK@K@KK -L@MpBTAd#0 $K$0K#K!PK`K"K pK@K@KK 0-L@MAT 0  K0KKPKK@K@K@K@KvK0 0-L@MAT 0 K0KKPKK@K@K@K@K`K0 0-L@MAT 0 K0KKPKK@K@K@K@KJK0 -\0LM@A0KKa0K0KKKKK@K5K 0- 00B1 0LM8_@#\ #8KKKK@K0KPK@K@KK0 0- 00B10LM8_@#\ #8KKKK@K0KPK@K@KK0 -LM@ _0K0KK@K@K@K@K@K@KK -LM@ 0K0KK@K@K@K@K@K@KK 0-LM@ KKCTK KK@KPK@K0KK0 -L@n0 4 R: Q 0 Q05:0!SS p-LMP(@`Tp   004/p -@Lkb40,0S ,000 @0000hccc -L(0S h 0@0Gb$0S0 0 0@ h{cc -LMP`p1b1@T,@T 0S 0S:$0S:, pR000000  B Tc@Pc4e Uu@P 0 P `$p0  0,P e u(K 04P 00 0 P  0P@  8 0cc -LM@R@QhB` u@P 0(0@aPp R-@ 0Kb@P+ 0(@ 0 00@S00  P  00@Q 0 0 0b R 0SbcP/0 S  0 S   S0 S00/p@-0`4 \P *0 S @  ^*p0S ^ 0Sp0S@@VU p -L@p`PP 0S 40S P P P S P S:\  R @0S/ B/40P/e s p-`LP 4P L0PU@@U4e sLP e sXP e s 0 1@0<@dP e shP e s`P e s ephs p-`L\0SX0P P@㺴X0P@PUpP -LP`p4e s@PP pP`0 0p0( p00 PP0@ efs -qLMP@` -K 0pP @$K`P  0TTP s @H,[Z* [+0[T ns @ 0@hP  %s@ p-LM8P 0`PU@PmPp -LLPp4@PA 2`@TD  e 0sPL0 T$0P pPS 0S) S \0 \*S 0S:P e r000S 0S@0 R 00 P T0 p 00@ S 04S!4000蔽:::: -LM@A 0 K0KKK@KKKKKK<2ST0 R 0@e000 (/ ƒ #30Oc;TgMbܽ: 0-LP@P00h 0-LM@A0 K@K0KKKKKKK@HPP K0 -LDM 0`Sp L0PU@@"U4e rLe r0 040L0w* ;K 0CPP: [R8[90[e7rPP @ 0.PP@ T e q(KPP0SPP00  0 \+Y P @   08P& P > _020Kh02Kb K1K/K,0K+PK0PK.PK-PKP_0[ PPp e 0TrP4P L0W 0@@W  qPP @TJ@TZ*KP*0[ : -L ! 01 R101 01XQc QP@] G 0+1X P@0Q0U0SU2G? P0U0T R ;\\ T 0 S  0S 0 4 \\T 01[OyX`Q  Ki+H 0 KiP!  -L^KBM@KPEp `00  PsV@ p = p<0d e@E0;:PD`d  TdX@d PeP J@ d ` 0 <$K耾:::9: - LPp =n` ;W @T m VQq `Nq PIW  m,?q8x9:̾::9 p-0L`e @mPP P 0@P 8pe mPp -LM, p@Ple mPP@p ,0 00-0 3,  0 P0? @p./12 00 PQ 0S _ 0S[  R0001  0@P78`d@ 0`P4 2@T0 001 @D 0`~P 2@T0@D100@}0 `f@P 30 0(KZ" 90S& '@0 0T0 ^ 0 S  Q 0 S Tg @?0@S@0?04%80S?0C$1 000 0S  3/P  @0 0  10 0S S\f 0jPF V8p ` 0  p@0Sd  }? 0  00>0S0 S !00`00\pp8 0'pV8  QP  0T_0 R 0D08::5:::T:$5::: -@L0S 0 S  - 0Lq 0Q 0`00d/ 0-LMPP\0@ @X  @ @X@PK0P -L M@04 P_P@$ X pp h0P" X G8@! 0K4 DTGd 0K0/K.K-K+PK)`K,@K*pKP (K k b -L M@04 P#P@( Y0 +P'  ipP! 0(8@^0K4HdDT 0K X0/K.K-K+PK)`K,@K*KP(K !i ꤪ5 p-0L`@PMP UUP 0   iph<0 @ QPPE  -LMR@80 pp i8`0^3K04KFT,KGD4K 1K/PK-@KP2K0`K.pKuP00P00S0,0 Y G8 h,(K -L MR4 @p ` ` hp 8P!0000K40EFD 0K )@K/K-0K+K.K,PK*`KP @@X ~h(K -h1L MQ@ P1Q& 1CQ K01Q800Q. Q< Q@00 * 4K K0 S;#0 0 SQ Q Q@00  D00 8 040P D00 8 04;0PH00 H00 UDUU@ 0-90L4@0090p PBUpP0TP TPXP XP@P @PPP PPP<P <RA p@ P0S@sSl`c -LMP0@`pkP0T 0T 0 0T 0T  0pQx xP 0x0xP 41 Q}fpUA~fvt 0-LM` @.Q@@0@0CS000c p-LM@0P PpD0`Vp LՉPpL048 ` Pp 0-\0L Ƞ Ƞ,A0000P0CS000c -LMP@Q`pP0S P0+||5`0P&V |00|0RP pKRP@0T0V0S T@#T@!  s`P  KR#``D: 0-\0L Ƞ Ƞ,A0000P0CS0070c 0-H0 (("ALPPLf &dxP0c 0- 88 #PL*0AT 0KP P0 PPP Df :dLxP0c 0-PP@L |0 l(xP0 0h0|0ᲑlxP0 0-90L@0Q!ڌ 0 S00 S P0 i90P0P0CS0PℑQncZc5 p-0LM<00P40@0 K00 K8`0 @0 D0 D 0H@ Kp(5L: 0 /OjQ Q 0S// -h!Ll! `RPp@ P@T p-LM@P`/Pp  0p`q9 p-LM$0@P` phXq9 p-LM@P`/Pp  0prq9 p-LM$0@P` ph\q9 0x 0-PQL@ Op00hpQ p-T2@SLPP`0T2S0L P2ph: p-LM@0PPD0SKp`KL P 8 40 -LpM Q0p`@P0 - Q `&pL 0`i+W@ p-PQL@ 0P` L`PU phbp p-1LS@`Pp3S 3/L ph 0-@LL90P B0 -4LM<00`40 @(@ 0P000K8, Kp ,00[@, 00UD, 00OH4 LRO 0400(@(@@(@ 0,@  @P#3 R; 3R 0]#Qxp1pCS*0$ <#j$K0 S 3At S1S 3 @^H0S00(K,"P (0 0?C0CS񟗂L555555L5555555555555585$585555555555555555555555555585$58585$58555555555L55555555555555555555555555555555555555555555555555555555555555555555L5p03 %`03 P03 @03  5S2:8q9p9c,q9p5,555 -LM@K KU 0PKY0S 0r0/S/s 0Rr0 ZR R/0S0w00/0S 0{ z0 /0$S$0w00/ p-LM8P00 K^X`!KED`!K K0@KK`K`K`KPK`K`yP[Kp 0-LP0@P 01S01 1S A0 T AT 0 1P AT10C1010C10: -LM@0P`pP  K 8#(T0 0 <000 <Q Pb p-LM8`0@ FTN!0L0QPSM@N@O@P`RL0@Kp 0-L@0PP00 00 P0 B 0 R000h -PL0`phP 01 s@N=00 00 00 00 00r` r 0@P00 <QA -LMP0p.`P800@0LL0MpQN`O`PR`S` L0@`BK -LM@0`p PP10@0<0NĠL0MQNPOPPRPSP L0K -LM@0`pPP  K0 08#T0P0  00 <Q P| -L MP0`@P. 0BS+5h55555,5P5  0K@ RY0S 0S00S S S 00 b0K`xT T 0R0 R AD 0@@{P  RTXpWe  00 b0T T00 6T1   \oT%  0cT\00 TL0Q0  0T800 @ 0  0T5 T 00Q p 0@0 PH 0PP^ VZ   0Sh 唹c00 04@ 0@G:S 0S t::::H: : p-LM`0P@P: 0BS50555555550j i8(h4$k 0 <Q  R 0PR 0($ 0,0Kp0S #T0@0CS0000 0PTP KphT}\ @`840" <S  j i(h0$k0 0@S<0S=QX0Sr St 004 D0PR4< @0PKX0Sr 00`@sP`@= VX 0BSwP1 X RU -:R+1T0Y RE*tid!`!\!}X!{,!y0Y0S0Y0O0Y0K0Y0GPiiX@Y@\@`@4`PY0PX0+?>0S]=RRli`0T04> H0$P d:h:H%:X:::q9:8:::x::h::q9 -@L0 0 4JS00X0ĵX0ĥ -L@40S0 0$ R 0R  R0Y00Y0 0-L M8P?00ED0KB0K KK@K0KKKKPKK04 -8LMȠ,Ƞ#85  q9 -@LG00hH -@LG0S00@HS000(0RR00(0(00 (0SP( P0(0 0(0 -LM@Q` $pSJ555052 %㼠 Ҷ00 " 0>00 01 0@0 T0%(KQ( 0 R* 0Q'0(00 (0SP( P0(0 (Ko`h0(00(KoC0@0 0!0(00(0D5:80S880[ -LM@P4`0LP3 pW00 00 0! T@  0 P0(Ko0+ R  RW\D0(0(Ko\T@$ 0AP(K58: 0-LM4 P0S K00K @Kᅶ P,KR)@K0R L( ̿0 %xX: p-ALTP` P ` Y01p p-LM` YP@ 0!0208`400201`0@92 ; @K 2_Y0 0CS 2Ց<2ő000@ 000CS0p@p 55tcԆ2@-@0 , 00\#^? p-PL`f?(0,@ $ p 0-PLNP"24  BT i0@Tkf0 0-LM@ ?P  XK0  ?P  I6$ \3> @PP  T2̠P(T34/ PPd::5:5 -2AML@`@3Pp0 DS@ 0@#C40<@3,O``  <}P  4;Kp30p3'5: -@LPP43SaV~pP P E01ALP  y0106 -@PLzPh\ -LpnP_ Ee43S _`0@0 "0R 1 S4#㬒iBF0S -PL`p=@PDWAI WW# 0 0@0@ lQW iF0 0@0@ | p1S 0^iF,\: p-LMP0 0@0@`\$D0 K@<f< 1S 3EKp: -L`PP9@U UUpp303QPU(h`#R00@`0@00@0@Co 0ѽs: 0-<3P@SL8HSDS 'P< 4P@ 070 p-LR`P H ; 0 0 @ @pJ@PL嚽7p+]1 叽7p; 000: -1L$M8KpP`JP 9@ U UU$K303P(UR ̠PA(0 L  @C  ,0KP 0, ,0S0 0@0@C 02뀃'KA ɱ%0[@T%@K,0 0C,0 0 0 c7P C@0D(10CGT*K" K)K(@K'K%PK$0K#K"@K!K&pK>P -L M`@^pP K@0ND)0K?0CHT)K! K(K&@K$PK#0K"pK!K'K%KP -@L {  h p-L M@`*PP Kp?0F"0KB0"K K!KK0KPK PKPK`KP [0[ p-L M0P`0K@P Kp?0F!0KA0!K K KK0K@K@K@K`KP[ 0-LP z@@T T ?  ~$ f& ~b?  (0hH~ U': 0-9P@0@L9 YQA =_(P C( P5(S,P :,P20,30P 00P003XP 0X3PP A0P3DP 0D3<P 50<30430/ 4咻) 医# 冻::: p- 3LP'R;OA9`@O b ㈏00S 0@ሆ|30CS|3Cpi -L`   9 8#8  )2S<9 9  h@@ TPphQP@@0$nWp -LP@PAp)n @VT7P# 7P%  C <a(3S 9 @09!Bh@忺hB,幺hBJP hxB:: -`LP@pvP@ 'A0T 0CT!  00@4T$ TB0T 0T0/Ҏ@ @ '@608#8@6j@6@@@ z@i 7i 8i8 -@LpP` & % (@@T ( T hf4,: -LP@`pPb %@ (@@T ( T &@:H$,: 0-PL; a"0R<  V0@Q  R#  E >@P0? 0 08#8 0hc} !Ss  0- L P# @@T #Z T !0h/卹D: p-L`@PP@4U0@p -LM@ P2#"`3#娃嬃ăȃS 08 Ƞ,Ƞ#8G t/?S!^0C @/@0pS@00S #0@SP   0P# P$#0@S3S 3S " K $3S ?&@K"P <) 㟭(1(!9! 1 !1!0` hK1!21_0p"2@r 0富 0`–\  ၆ᣊ x儋@ 0` 崍L ͍,5$5`:|w9:h::5@555L56l5552S/ -@PLqPhS -(3 @SL0#$8# P( P, (7 -@3 @SLH#<P# P@ PD @7 0-L@P + 1P ; 00T0@ -D2L$M @0?# 0     ,0K@R,pP   PP囬 ,Q /08, #X$ Q%@ 0K⇬[2[ :,: 0#AS, QP0:p 08#XQ30, 5:c, e@P0 0@0@U 帷(z96: -LM0S 0S  0 Ƞ8,Ƞ#8" pPHy9 -LbPh6D p-PL9`@09iaP P6cP P403P P03HP 0H3@P 0@30P 003(P 0(303p C <@ C $9 C 2$::: -LM?`PB 08#8႒Ⴁ @ j"K2KT,K ,@@L,30 0p P j@0S (,3/  p(}P b(K0K2K,,K カpꂒႡ j ,3 np\30\3'6 -PL3@SaV~gP P >LP  q0106.01 -pLP`pP$=V VV$ 0 0@0@ S" x其V iI>ia `1S 0 0@0@i6>0H: p-LM0 0@0@P` \U<0 K@(( 1S q >Kpd: p-x3LP:P P P <|3`0CS|39@O ] 000S 0@ᦇ0|30CS|3=p≉j p-PL`]?(0,@ $ p 0-PL"2  BT  `0@T\0 -LM`PpP @0?0(0K(0K:CJGĠHC6 (K%K#K"0K!@K'PK&pK$KUP K 0-LMP@0( P(3S  0P  H0P  00 0CP  0P< H0P 0P (0P" -LM`@ 0S RPpK0\ pn![P04"48#(!K[#<U0@KR -LM&pK@d P K 0K4B [0[48!#8 ? ("(0! 8#( 2S<8 #8( "h908#h 0p 008P#h PP00K Q 0 U A4z9  p-LM@H;_`$0b67Pi 7P 0P=3( P3 P3 EPl 0K? [0[ [ 0 ?P C Xr9<Kp3#4  ?PP C W< )΄0{7P F <D3@/ P&@9@0Q9S;[2 R ,"; ::a:6: -PL@`p:1T% 0CT-  00q@4T ;0T 0T0/B@4T6@ @; @ ;@608#8@6@@ <@i 7i 8i8 -p  0p00LMP9@ 0@Q Ro 0R( R) RS0,3@00?0 A 0R R 0 `P PhyS S?  S S : p-@PLp1Pp_p9`rZ3S 〇ph; -@LyN|30CS|3h|3 0|3TN -LMP@p`P̃X $KG4%0K&pKh 0`H&K 0HA @40`:T ! : -LMP@`PsW K"`K!`K 0`"K0|   @d0`T ?!["0[X   Ų 0: -LM`P 0`"Kx 00\ `B[L2BKTR 0< `($4Spm <`K @ 0@0 @K 0@ W0 @ 0@ H0@ 04@  0@ K 0`w(p3` 0 0 308#8  0 0H`OZ ( 0`FQ  " -LM0p 3P0 2 08 Ƞ,Ƞ"#83@o3sCC_L3C3sC!3 P,P<0P<`3 " 0S;930S@00S #0@S#P   0P# P#0@S98 χ0p O0x f 0&PK|OP0e 0χXLჱ0qv\(zፁu)  0ph1!91!1!1!2!1_0`"2@b 1 0X—\A  O~ T9 <3 K0&PK$OPX0 a0kpu03m ^0l 0 t Hy96H: 6 `0!::Э9\6t 666666 66P:`:h::: -@PLPh -(3 @SL0#$8# )P( 6P, (P7 -@3 @SLH#<P# P@ PD @57 0-L?@P +W1P ; 000@ -$3L0M8Kp@P`CP9@ T& TT(KPT 6@0*} 8#D0hŸ   5   ,0K@,Q0 0@0@#0Q O"88#QW:8#8SD0 H <@ 0 0@0@D< 0A8#8 D0 < @d1 0`0SE0SBH <@>$(0))?@ [P @0C *2 08RR#820 2 گyp ӯpo0 0@0@dcDHD<弯D0@  Spz9&6:::: -LM0S 0S  0 Ƞ8,Ƞ#8 lP6(06/6-6p*6*6@%6P::: -L@Ph{8 p-PL9`@09iaSP 7P6cP .P403P $P03HP 0H3@P 50@30P 003(P )0(303p C" <八 C $~ C w(::: -LM2p 0PS: S S@` `.j 2၁C0 , @0K  ,,30  0`_P 0s (,3/  `%(P _(Kl,00 19,0 ,  `\3 0\3:'=6 -PL3@SaV~yP P yLP  1@608#8@6,@@ @i 7i 8i8 -3 @SL## 0P P 7 -l3 @SLt#h|# 0Pl Pp l7 -1L$M8Kp@P`0P9@ T& TT$K hPOTT /@4u0#T0   w  (0K@1(ꁝ,0(#!I$IL  ( \ d:( fP s(\ \` ,K0 0@0@P 峨Tz9D6: -@L6C 30CS 3h1 3 06 3C -LM0S 0S  0 Ƞ8,Ƞ#8 XPz9 -@PL0HP01h* p-PL`O?(0,@. $ p 0-PL"2  BT R0@T0hMO p-L M@0 !DP_`$K0 K$0K<0C@K#K0KK"K!K PK@P  /Kp: 0- @L(,0 $BPP00 $A0h 0-LM!P00 @ P:98##8 Å <9)7 373 C #K0h2Sʜ:P3 @@3x "0K! 0TK0z9 -L M?0!DP^`p0(K(0K KD0#@K'K"0K!K&K%K$PKT@P  婧 00KH: 0-4pLM@P  KPP1  ((    ;PP0 偧0 {0:t: -p  4p00LM p9@ 0.@Q @  ,( KP3,㺏0@ = × @ 0W`!0 ƌ@@Ç(0(000(0 (0   PG( @,@ ! pR2@S ST×(0&ł0@(0 ÇT :: p-@PLp0Pp_p|-` N3 {ph.l -LMp`P@$K$0 3dT   P@   p-LM Pp @P PH崦@ ᰦ`p  [  @P@T P坦(0j@P @K `P P ሦ@P傦0: 0 ,8 (l*$ @P7  /@P/0$ 0 G , /@P!,30 3 # #P P/yP <)sP (#mD::|:::0 :<:l: -LM0P002@3$C(C6 Sz@2DC83@Cd::b6 -2QMLP`03@p0 34C0#00#C40,03_``  w,P  46KX30X3'_64: -PL@<PaV~qP P pLP  ]0106p01 -@PLP7h -PL`p@P(WAI WW# 0 0@0@ lW i)0 0@0@ B p1S 0i)": -LMP`ſpP K0 0@0@\l(0 K @,&, 1S)\: -,3 @SL4#(8# %P, 2P0 ,L7 p-LR`P H ; 0 0 @ @pF@PL喡7p+Y1 勡7p; 000: -1L M0Kp@`0P$0 DP 9@ V VV K`30`3P/VO ̠DA0 L @= $0K`呿 0$ ߕ @0 48#8 S$0 0 0@0@`C 0|%`%$00 0 d7P '@0m(.{9b6`: - @L<L#J7P @3S [P@ hPD 7@7 -LM0S 0 Ƞ8,Ƞ#8 婿P آc 0-LM?0@ PK0KF0K0K@K@K@K@K@K^PK0岠L: -L MPp@R P 垠K!1 @/@1!|3#ss K@P 0PS00S"0@S ־P9   0P" P"d&@K&`opP U) 0 9!0 1!0@ 0ph◖mr Hr( 04l:i6k6::hp6^6`6_6P: p-LMQP` ?0@0 0K 0K0@EĠF K@K0KKK0KPK`KPKp -LM`pҽPP KG@0HD (K(0K'K%K#@K&pK$K"PK!PKP p-L M@`ᱽPP Kp?0F"0KB0"K K!KK0KPK PKPK`KoP [0[ -L吽Pi@0``pk`p@_@P@Pm@P@PoP0 0@0@ p-L M0P`0KZ@P Kp?0F!0KA0!K K KK0K@K@K@K`KP[ -LM@:P K@0  K0KKKKKKKKPM: 0-9P@0@L9` YQ4rP wP3RP nP002P dP02HP S0H3@P 0@34P G043,P00,30 4  ::: 0-2L@7⿸⼸j%9P@00S 0@tpi&0^r 0-LMP 8#8,2S<9 0@\2  .>0 0@Q2 P @@n++!0T 8d #8 )@< .>[0,n;;1" "2c -LP?P9@@$p" U)ngd @OT9`   F7P) D7P {$ 8# 4" 0 ,2S 9 @09!%hXr@%h%,h%6P h%:: -PL`@pܻP@ $01T 0T  00ho4P@ %& = S, @S @ 6 3@ %606g@@ 6@ @W 3  `1 ` 3 `$ i 0-@9P@0PL9YQ P3RP ޽P002P ԽP02P 03P 03P 02P0020  4o i c::: 0-LM@ ->޿P  NK0 ?ϿPP  L?̠3,/ P 庽d::x6 -2QMLP`2@p0 B"_ Ϡ,͠0 ?  lC4B0b2\\  冽P  0=K303u6: -PL@岺PaV~}kP P TkLP  X0106Dk01 -PL`pᆺ@P:#WAI WW# 0 0@0@7 l嚜W i^$0 0@0@ p1S 0iK$好: -LMP`HpP K0 0@0@\g"0 K @婺 1S$i: 0-2P@SLRR 娼P 㵼P 070 p-LR`P H ; 0 0 @ @p@PL7p+1 K7p; 000: -1L M0Kp@`0P$0 ̹P 9@ V VV K$30$3DP2VN ̠@A0 L @Ź_ $0K`$ R @e0  $$ $0 S0 0@0@$CH 0l媛$0 0K h7P %"@0hh^#巼{9x6`: 0-@PL S M7P 3S P P 070 p- 3LSPp!`P f 4029@ 00S 0@l|f0 3#p p-`@LP OP 4ph9b! 0  P/Pphul:6 -LM0S 0 Ƞ8,Ƞ#8! P {9 -L@ P/{P  h9: p-LMQ8#H`@0?0 0K 0KP$4& KPK0KKK@KK`K冼Kp -LMp8P6 0 4S ,K0 KP !0Ś(K忚,P 帚 ̠8Č#Č"̌ 0P @ d ᣚ ,54 <̠ČL8 ČD"̌#D!L  0@P  P,<4("!4l̠ <($Č"Č%̌ 0fP P  ,3 <:::,:T:|:: -L MpBaP <K K⬸@P 吸0PS00S"0@S 儸P   0P" P"\2S 2S8 ( +0P 2f 0?4P& o +N@`iP ۙ) r|0| 9!t0t 1!0@ 0phugk0 3!,彙:::P:::6u6v6: -(L"M"(@0K K0KKKKK K KA K -LMP 2S.0$!08#8  Kh..00Q0" "2p488S@`   T` "2p488S@ 0!B!.N0,0•)0 0PK Kh -LM9P@` K@)΅ 0p@.9..  00 00 n@ j7P 7P w2S 9 @0!9Kh @Kh (Kh P :: -PL`@pẶP@ k@1T 0T  00Fj4P@ & = S+ @S @ 62@ 606w@@ 6@ @g2  .0L   2 .>  ("(  i -RLM R R K0K ɶ培 p-`LPDPp0 0@0@phd: 0-3P@SLSS 弸P ɸP 070 p-LR`P H ; 0 0 @> @p@PL.7p+1 #[7p; 000: -1L M4Kp@`P(` ܵP$9@! T. TT $3S! TG x1$#$$3 S0$3XXA0  @Եn$Kޗ巵r ՗$c (0K `? (`(``F(` V @ ^(0 S 0 0@0@ָ0 0S ]7P -@0pdf|9'L6\:@: 0-@PLR B7P 2S P P 070 p-LM@Pq 2SK 7P 7P  ?P  DVKph,OKphHKph  .>ȹ`P  8Kph2/ `屷9@0a9Kphτd +> @bP  , Kphd::::L66|: 0-@9P@0PL9YQ g0P3RP ^'P002P TP02P 02P e02P 03P0Y030U 4帖O 岖I 嬖::: -`LP@pqP@ "0T 0T  00g4P@ P @@D608#8@6 @@ o@ i -邡ႂLM0j`@P3p /00 \  @00 0! Q " $K0j 0 ׊@j@c0"!B 3/LL  寶P "$K303(|9' 6 -PL@PaV~dP P dLP  9Q0106rd01 -LM`pPᳳ@P KeUAI UU/ 0 0@0@b ŕU* $K 0 P P$0S 0 0@0@1S 0k0 0@0@延: p-*3LSPp9`@ 00S 0@g`0*3Bpw 0-LM@P ɳPP  0 Ƞ8,Ƞ#8@  5P 0P 00 SS0 {9 -LMp`rP壳 08 Ƞ#8,Ƞ P?4@K%VP S MP 0$S0S? 0S<Pz (0S@(0@SP$0q]P 0 S$0 "ز(0@S2S I02 `R@0Sڬ2s<P  @ 00S0"20S'@"HP0po@P ""0`S0@0S"0S PQ   0@0S"0S2s 2spW2sy 2sr Yp0` >K,K0C (PKA 1f)d@ q1!9!|1|!1!0P h⸊b2f0*3% Y.0S* O(K222SYD ?;90 $00B SAB Qa0B7 BSW B? 2"0 P2 PD8{9:6`6І6`:::::4:::/ -@L 0/30CS3h膶3 0 3 /P/0墮 p-PL@0`ᲱPp6@ =  0@ (0,@ $ H3S0@ 0$@pL0@ 0$@(, p:?(0,@ $ p 0-PL0~P= H# 3  CT =0@T0h:0 -qLM0PT3@0` XC;QA40+ @T/0T3PT3H   X303P3@0CS3T  dV0  KT< a;<0>׵|30|3|6: -@LP0PH3SaV~aP P a01aLP  WN0106 -PL0`pذ@PWAM WW# > 0@1Aቼ W iB? 0@1 A  p1S xi3H0330CS3[: p-LMP0 0@0@`\嵒=0 K@PP 1S eiKp: -P3 @SLX#L\# 0PP $PT P7 p-LR`P H ; 0 0 @v @p@PLf7p+)1 [7p; 000: -L2L M4pKP`0P&U& UUpp h0l0h0哱PCUK AD0  @3 03嫲30CS3'$K(0K  P_(0S 04 C( 0  F? 0@1A R"< 0@1Aᄴh@冻 0hp3D0330CS3mPl0R @o(00 0r D7P L@x^<9l6`: - @L`p#6,7P d3S 0 Pd ,Ph 7d27 0-LM@0aPP K034038 D0 P  zP30CS34< H0PP  HeP@S/ 0@S4TP* 00S@8<0S80s" <0s @0s c*@K 0`P ̍@0囫$Kx弍]d嶍 M  xp<1` !90p hb|0@0@p0 0P x1WDN4 $l::6x6<6p6:P: -LM0S 0 Ƞ8,Ƞ#8 孨P 4c 0-@9P@0PL9YQ <RP 5RP .RP 02P B02P ݷ02P06020 p-`LPePp0 0@0@ph腉: -LP`OP9@VVVpp,320,3ɨPVh芪C 0],s: 0-LM@ ->٫P  IK0 ?ʫP ײ : ? @|PP  T#̠24/. P垩d::6:6 -2aML`P"00p2@" • 0•C40 •B( 0"C<02 0xB 2o\\  ¦\P g 0ʈ K 30 3l6: -PL@刦PaV~SWP P *WLP  C0106W01 -PL`p\@PWAI WW# 0 0@0@  lpW i40 0@0@ 囶 p1S 0i!{: -2 @SL"" 孨P 㺨P ԧ7 p-LR`P H ; 0 0 @ @pѶ@PL!7p+1 N7p; 000: -L2L M8K`@pP,p ϥP9@ X XX(K3203IPaXn ̠A0 L @ʥd ,0Kp,pWP084 0LT 8 T ,p084 0Y0 ᭇY  @ D|  H b7P " @0eT[0 0@0@C 08倇s $z在글96P:l:`:4: - @L#/-7P 2S ƧP ӧP 77 0-L@P0 P7P 7P 2S 9@09010@/0hP 0h"0h:: -`LP@pP@  0T 0T  00rX4P@  @@608#8@6 @@ @ i 0-@Lc 9P@00S 0Q0 -0PL2Rp0`S@00S"0@SP=   0P" P"0@S2S( 2S% 2S"  0@`HX)VP |分x0x 1t0)1l l01!0p h|%TGXh;4hn( hi:@66L6:P: -LM0S Q  0 Ƞ8,Ƞ#8 "PPc/ -@L u!30CS3h˨3 0 3P! -@PL0P0hߠ p-PL@0`Pp6@H0@ 0$@(, p:-?(0,@ $ p 0-PL0ϣP# 3H  CT "00@T0h,0 -qLM0@P `T3oXC ;R' @PT3H /  嵣303PL3@0CS3T P T峅0j KT<bAz<8|30|36: -@LP0hPH3SaV~0TP P T01TLP  @0106 -pPL0:P_ {,H3S _`0@0 ,#0R 1 SH#PxYi xS -PL0`p @P WAM WW# > 0@1AẮ W i B? 0@1 A H p1S xji 3H03%30CS3ጧ: p-LMP0 0@0@`\n 0 K@P(P 1S 5 Kp: -P3 @SLX#L\# 0'PP 4PT PN7 p-LR`P H ; 0 0 @㨰 @pH@PL嘄7p+[1 卄Ų7p; 000: - 2L$M8KpP`0HP&U& UU h0l0h0ţP4U^ ̠AD0 L @F3 03ݤ30CS3$K  ,0KP呢 0, x,0S< 0@1AŦh@ǭ 0)h &KAx% [&0[4  ,0 0C,0 0 0弰 \7P  @xP 3D03%30CS3ጦ96`: - @L`p#687P d3S 0KPd XPh 7dp7 0-LM@0堡PP K034038 D0IP V 幃P30CS3D4< H04PP A H夃P̠dDh3(6. P兡dd::6 -LM@PP`p# 0VPU?0@0(0K(0K FH0%K# K$ K'0K!K&`K"K3 030(K3P0CS3 K 0-@LMDĠ DKD\0KKPK@KPK0 -LM@ NĠ0KKK@PK -LM 0K c P K -`PLP@p0PUT T Qt0T 0d dThT T4 $ 7؀9:BF -LM @0K@K@KNP [0[K p-LMP0壠P KpA8#8 K@[w=8#8 @H $(2S<8 #8( "h=08#h H D V08P#h @@R P 00 @  01 0 0 T&* -LM@0K @c P[K p-`PLP@ 08PU @p$T T Q0T 0|x O@T@pT T<Q H( H7:9BF 0-LP0@P0L@ T @ 0h.' 0-6@@0P6LQVPUDP uD>P+DPHP lH5P0H0lP $0l3dP }0d3XP 0X3PP q0P30H30k ΁e ȁ::x -pLPEo@ @zT* q X7P噁` 7P厁U  K(H0S D0S 6@@06A; PUP 0 /::. -`LP0@p*P@ 0T 0CT!  0xR@4T$  0T 0T0/U@6 @ P@608#8@6[@6@@@ @i 7i 8i8 -d0LPx`&0ܚ0ٚ3p0CS3ባ=@O \( Ux0S R LPlT -LM0S 0 Ƞ8,Ƞ#8 囟P 9 -LM`Pp0` ĩ@P $宀0凞$K3C3C S2CCS3( K@PO(0 40 0 Ƞ8,Ƞ#8a=4080@0<0 `RCS8 0@S4՞P3 00S@8<0S80s) <0s& @0s# .@K'`.0`pP J ߩ B@ l9`5GP H. t xPyv 1 !=1!1!1!43 ! 1Ox`8#<3Xc 0S 0p'Õ\  UMQP R C 0l TX Tl:6:69L:::::@6066666 666@->@ 0@Q  /R4 Q QR03R 0-LS@P +k1P 0֭@ -p3 @SLx#l# 0Pp Pt p7 -X3 @SL`#Th# 0؟PX P\ X7 -1L8M8K@`P0'P>@ T& TT(K⤞PTTY  @L#(ux0,    ᳟,0K  @m,0pPsP08#8X,0X0CS,0 0e:,0 `@P PP s ᪫,0S Sp PKB? 0@1 Aᇨ ~x \9$6: -@LP30CSP3hhP3 0P3 0-@PL00嚜P0NP%3 R0h -LM0S Q  0 Ƞ8,Ƞ#8 vPD9 -@PL0fP08hH p-PL`%?(0,@ $ p 0-PL3$(#03 CT T00@Tg%P0 -LM(8P0@"h#x)PT@0?0(0K(0K0&Ġ'0HD (K'0K%K#K!@K&`K$pK"KP K -LMȠ0,8!( K 0-("( LM#Ġ(@#\#K!"(0KKPK@KK0 0-!L(MX"%X3  0!\8R# 3  %Ġ(%L%K"(0KK@KPKK0 p-H$H:LX0,`J J%XH$0,phl p-@@PKD`LHX$%(ph! 0-LP0<("!R8#(  M%Ġ(%L%K!"(0KK@KPKhK0 -LMȠ0,8!(0 K -LM(0K!"([ [[ 0[ K 0-hPL,@90,B8,0V(,0Q,00h2( -L@0'P>$<>,`8#8 2S<8#8 `P>`0, 0,0,i2SP0 pPPyM P @00rU<,4$<,!4 $(\'<` -H$HLM(0K!"(S[0[ [@[T @@0 K 0-H$H:J JPL,H$,0l 0-LP0@᝚P0A!@0 -H$HLM(0K!"( [0[ [[@ A0K 0-`L,0@PP0ͣU ,, U0 0h|: 0-@L,Ps08#8 ,^ ,0,:0,,0,,M9,:@@0兣TR p,  TI P,498#80,@@0jT; ,l  T2 ,@0,,08#8,,000 ,P80`0H@x@0d,\\0,0hH{<{ZOT@8:\: -@L1.03 h,X<,6 6<   0 ,08#8,, 0 0,q0, 08#8 z1.T0âX 0H D0N@@0 hH 2LO" z4 -LM0P002@4D0HPL@P@2dP`0h@l@4嬙93 `R0@0St 0S4垙Pf   0@0Sp 0S@03&{, QO 1QZ {(`K+K{. o/ P\q1!>1!!11<#!@@3o0pD#3`As `1N3 @" Õ\0  OHL M K z3(`K03,0 z3(`K03 ,0z 0p O\ Ox6:p6:|L:Э9|7l7l6T6t6|66H6P::: 0-@L>P@0>^RNxP xP)xP|P |帚P0|0xP 0x3pP 0p3`P 0`3XP00X30 Sz Mz:: -bLMaFp\C0P1 ,K,0 ( n0  ǧ@ `SX\3|XoP @ @X嫚P $K3 03' 7 -PL3@aV~HP P HLP  7501rH01 -`L0@PᴗPhUp UU# F? 0@1Ag xyU h^R P2S > 0@1Ah{|Қ: p-3LP/|P xP 08s0TpP3`0CSP3 >@O   M0S @KD?pM p-LM@P7P^ 7Pa .>!,I0,6,@08#8,+, 00,nx,+h0,>T    0,4p x0⣛P  yKph4t |0ⓛ`P  yKphxKphxKphxt3pl/ `Ԗpn>b@0> MKph?Zd::::$6 -PL@`pO1T% 0CT-  0)J@4T |0T 0T0/L@4T6@ @f @ 8[@608#8@6@@ @i 7i 8i8/Q/ Q / /0$ 0,B$ ?t.p.-08 ?0R<  C4<0?x.|. 0-@LL P0CQ 0S0h0 <?.. 0-@L4 ,0RP 4?0h.. 0-PL( 0S 0@@0. 0-H0 L@4P 0000S \?0hP'. 0-D0L@q4P 0000S E?0hP'. p-t0 LP@X`P H 0000Sph%?0 P'. ; p-PL@60` S  Rphj00  ?. -`L0pW l @]\0@").xPUK0@00 ?P0S 00CS0>00l0\0 00@0,000$0(%'.c: ; 00 7 -@LP p`P[]00h>. 0-0@P00LG000. 0-P@LQ 00 S|0  00S:R   Bj <0 4  0h=  0400h=p.t. p-L^ @`P  ^* ^&0 ^"1 P 0S jpl0P T0 ^ 0 R 0Cp 0PP'.... 0-LQh@PT0  0CR0 uj00 \P'.. 0-p0LP@ᚓP0T0TT0T08@8 000ݖ00CS000hCp''' p-0PL@wPp+T` TT 2 \uT phYphW<@< 000笖00CS0p':'' -LM0` 0 2Pp@@P"T" TT; T9 TB 1QA 0%͠ %L @B000ٕ00CS0%K  0K@卓 R0 QF Q? 9CS7777,7,7t77ž0 $uᴗ@ 000>00CS0ᥗu u @ hp'''7`::: 0-L@ 0P0 0fPq 0xth P00CS00P 0D =, P0P a $ C0?`% V Pp%-s\$K0S2*@KP0RK"K2K2R6 0R0SQ2K?2K*@K02K00C SE`7X7P7$7H7@787$7$7$770@"02K0"K*@K2K 20Se 20SY S08#*@KK!PK0`20pLK&gW?F K4KguP`V000000 R  Bghg1! M 0@] 4P ` 0@P @ e0 R08#Q 0*@K2K0"K2K@      P'D$'P:,'(D##'''7t.. -2LM ?Rp` 2RS 0RD Bn2"p 0 00@03gT2T"@]0P8B8Ÿ   @y-4 0@? S+ 1 R 1R4 -d0CRD 0RI T1 @1 9$K0S@? *pK2K"Kl1 *pK2K"KT1PH!0S01R 0R0AS 7x 7l 7` 7( 7( 7T 7H 7( 7( 7( 7( 7( 7( 7< 70 00 00p p <8# D$ 'p.t.''7'(.,' -QLM0`(!(q$K1p 0 ?% X00DP\Z, =@  kfedfafP 0-  婏CP M0( Hq 4%=qꀂ9:..''''7:t: -LM?pd0 \`,0 N \D1Q  A1,A,Q0   0 10Q @50 p0pᴠᶐ,0@000e0 ]@0P}@ 7<7P>7=7,#(3!3yDp V ""2! "7S7SFV  F"NoiL2!_ 0" "2!#)D !!1!#@ !1!#)D {VX! -u7SP!mL1!h#@  a 1!\#)D V0V  O J F0!A#)D ; i -54 180!, ( -V<Ѓ99x99(9`99@9 -LMHP$lCt? $H(K(K'K%PK$@K#`K!pK&PK"0K֋P Ǔ *j KP: p-LM@K 0P[0 0a[0aKA[ $$$ $ Ƞ! ,Ƞ 0e.`@ 0@/o0E-  0,< <0ppl 0-0h 60LSP0CS006 0hMY(i00 @0@09 0-PP8H#CA- 0 ß  PۆuP [(K!= PW 0!R R8S S0 { <q"D04;20 00\pW 0m0@@ e@@ ]@H$H@H$(@ህ4 8 41S#@h Ԗ7 0@'@ <'< P0@0/.000b 0q @B `PDAM0@005DT!040 84Qp '.0 4!P厖! 0 P P4͈P@ w S 00@@c @@H$@8a 4 < d00/.00ʠ< 0b0`d\J7p: p-LM6`@Pp 1Sp81 R01p00 0P  3# }P90  060 RzԔ@P7Sp6@Pp LP  # K@P 0P  # QP Q 0"0 0@0@pp -pRL@ WW9 gW$ 0 0@0@0P` ` p 0@D0 @ q pmi>0痈: -LJMR`p \\ \8 :ˠ\B0 L @@ڇ(K ,0K啅, #R0 0@0@0@ TD⠐ߕPPi +1 )ga:H @! P  0T 4 8<#8@!:#:0 0FM< 0S( 1  14p 0 p0C 000 01 1 0 ,1 (0KⲐ@!SdTW  !"'PP@ $K488p04(Op;,0 NH  0 Z21C! c%-  P0U彅P@( :0 և@P  FexBe@ 0Ç@PG@P 81eȎ $+e'eP e @@ ˠ0A- 皅P@7S  6 n ~ 6@@06A70S  e `@dY꤂9"VS:: :::@:LPK7D`: -`LP@pᣂP@ 娂Rh1T% X10SL1TA 0{5@4T@ $1T 1T  u4P@ nބ6066@ @@ =@ u4P@7S 6A0AS@@ 05@6A0AS8'@i ϖ1i i i -L@W4P6A0AS4@ p-PL0` -0 0v~<00S 0@Xd/P σ0?JP ph@P ifwpC 70  C 87  -LM P (Koc. o@PT //0PSʦ0@0S/0SEP   0@0S/0S?s ?s 4424"0 C   x62"` C `8 m6 4 1PnpO30 pc17 gg5Xp 0X @RX1`/VN>0@818!9!010!1 0@!0 hX"1X1"20/2 TF  X05 0 D0C @<0D BD0(K(KoMc (KoGc|(KoBc:,N7 O70,L17:`t8pt8BLU7H78A7p07M7W7(::: -LM0S 0 Ƞ8,Ƞ#8 P 9/D/ p-H0PS0`04SLpU @T@T 0 R000S 3/PpH@pp000S 3/HPp -@0L<@0D0 -L0` 4#APp0Q ^7^7]7]7]7D_7]7 P2\@P 00@PPPe wPP 0 $7WP00P 00 0$0S000 0$S0C40+ 0$0S0000S0C40P  0$0S000 @P V 00 0C 0  00  00  @ 0$0S0000S0C40`g p-LM0@`R@ PP0 $RL  Rb R 40Sf 00 K]p2RGH0S0\B@@ @ 0 4 R 0S0C40  0 @T@@ @0@8 0 '@`@<8 N0@@0<TKpHP 0  $("( RL 0CR K$a0P 8t0R1 R@@ 0 4 R # 0S0##40 0R 0RwHP 0  $("( 0$0l~,@@ nL@c_74: c c 0-00@L@P0S R000H0 0  0h p-L`PD@T R000H0 0   PL0S 0D  p)D@Tꐻ: -@L(@ 0P hahU;lc7L: p-00L@@P0`S0H00H 0@H@0Dc(ph 0-LM0 @00P<@0`T`0L0K0T@!ʴ`D 0D0H 0P `0L004 0}P  H`0L0T@D:$K0h'L90:D:2:l::(d7 0 0  /Q 0S3:Q 0A Q /0   /hgjg 0-LP@T00 0P 0T0C? T00\00S  00 R0#03\0S0 00s/P Q AP//0/0/0// P/0 R/0 R/P/\ P 0 R 0 R/P\//// -(L"HPT  -(L"HPT  -(0 0@00L0P,00 0,0 40 -,0 0(,00 L000 -,0L0@ (00 00-0@ 0 0, 0 0.  , 0-00 00, 0 0.  , 0Q0-0R00\00^00 0-0L0 @PP,00,00,00 p-H@LP `0S 000 0@@0ph -00@L PPH 0-@LP0$0 @$0P00@0@0 0-@LP0 P(0  00P000h? -LMLK уP K 0-0 LP00@P (P8 10 -@L00  0e0C 0 hvP/e q -L0P`p4e @PP pP` 0p0 0 ,p(p0pp000 PP0@ eD p-LM`P@jP 0 K0P  0R 0  0$0  $@00Kp0 -LM`x P U, 'e B@P e ;P e0 ` 0,0'0P0 @ 0000@ - P`ULpe @P e P e 00 0`P P0 0 p PP0@ 0000@ p- LP`e@Pp e P ep00 0   00I B00  V@0 00 @p -@RL`P 0S@p@eXe pP 0T 1 !Rp@IR -`LPU030#QZp @P` +RW%4 0P` -LM 0pSP(`VP" $K PPe  @$0T0$00@T  PPe `V0 0 -PQLp- 0S* 0S' S`~P@1~@# 0 fP 0 f 00ST  0000 SQ:000 -LMP `0 Ƞ(,@, 0 Z@P`00,p)(#,< 0R)< 0 P0  "< 0Q 0S \  (K -LdM@LKP (0tpKN (0I8S@5S@ `e P @  0 Č@ P,Ġ.0 @ P @n\$K: P-L 00 ]\d9(4:fg -@LP00P \00: p-PL(`@V0$ R0 00S 0R: 0S  3/0  1Vp0S 0S`pph1 00#V p -LMp@e PPB 0 0@LMt0s 80z0< l0Ruz@vu\0@ 0vl m0qpn@o@r@8X 07`P  eK<0<@0P8  e`S 8 N0``G<kP@ <@8 eu` pP0 @K0PhP 0 P '9P4_7/ 0-@=tP@0PL=]Q0tP0 0-LM@P T0> LDT0DD  LPtP[K0'7: - L[ : -@L= @0!=h@ p-`0 0@0@LP,g[016@D3ph%: -PL@p`0T 0T  x0,4P@   @@608#8@6 @@ a@ i 0-Lȉ@P +1P ; 000E@ -L MR,`K0pP 0  ^^ "RO R "G͠HAHX0 L @'`PZK2S02 0K > 0S S=@ @P 00 0X XObB@x'{< 0@1A0Z Z"ꐅ9|7 :\:@: -qLW@n1)PP2S 0 S)i踈 P (LP  0106(01 0-LP@x0h! -L MP̠`Ÿ 0 @@@#200 \,4-P 5ZK480 P \'Z8<p @0P ,Z8@ @0pP!@KN08$ !0K0 K0KK 4QP Y4oP YLPLTPT0XS P @8@H QP<8@D H@P YY͠PHX0  @P9PY=x@Ph+)Y0 =!|0| 1!x` OI'k+``(:4::@c$7L:h::::::|7:0:H{7X~7z7 -LP`pt@PMA t@V > 0@1A1S \ -h)B? 0@1 A 0-)@-P1L`QApL#IFC(@'=&:%7$4"1Y.x+h47 -)LP#p3 - 00 LR s  0 p-,P0U@ `80<@@D LpT0 Pp0PUp 0-,@LTP0T0 0@T0 p-,P0@ UL`80<@@D pT0 0PUp 0-,@LTP0T0 0@T0 -LMQ@ 0?.C""0X XH:p: -PPppL*(0,P`U 80S T V0@T404040@3TW H0 ST404040@3Yx: -LM0p00Pc(0|   0, (0QU< , `R0 R 80Q`<0XD< , R H P00P0S  \00 S< H<8  H(  4 @Kx x0, @P 0 X5P ,000S, 0040,0,40H`00 0@004@(K X7l7: -LT00S 0 3@Ń 0S 0 S ?>#R// 0-\0L @ 8X0 $HX0P $8H\0Q;+S   ; S00  ;  S00R0 -L`pBVL@P B/0bP0T |0T d0T \0T ULWD UAU!U\0/0\0p*LXg+ -\0L@ p* -LM\0Xj `0 Y I 9 ) d0      ``0 L 0L\` 0+L 0LB_` 0+L |R0Ll0 +`0L DR0L`0 +`0L R0Ll0 +`0L Q0L`0 +`0L0a\p 0 @+\0 @0l \0@8` L0L^l 0 +`0 \L QL0 `l \ 0 |+d0 k \L PL0 ll \ 0 h+d0 Y \0 @0l \0@8` L0L^`0 N+d0 A   -XL80 $p@@P`F*k0Sx0 k@ S x|  0@0 ,@P`@00@@@@P`|0S -X` @0PRL$p @$P@ 0T8 0@vh D0R 80R P00 <0R 0-(0LP0k\0@08\0 X0$HT0X 0h p-\0@L$!;98 XL}iPfdU 8 X0$H` PL P0 p\0 p8;X$Lp 0-\ LP@/ d0   @08#  P=8#0X$8 LX$8 <LTO\0?00p@\0 X"(}y)0` <C308#(  ;8#(d0 ;8#(0X$8 L\0@ d0X*, <8#(0$8 LX$8 <L0x \000h \t?0@}T 8 X0$H @ @00 7;: 0-LXP$ 6& 0S 08 $HX0@8$ H@l h0R 0l Sh0 T0h@Bp0 -LMX0p0 ,  7 0  @P`@0 0 PA W UXk)00K0@0Y08$ L0X$8 L\0@(K80X$ L$8H  \0  (Ko꜅9: -LMX0@80<@@Dp8X0 $0 HX0@8$ H,   80P`8P<`X0$8 H   @0P`8P<`@D(K  0I@@D  ,  0@@@D00@0D@8 X0$HX0P8$ H\0@@ ` : 0L@@D,0@ 070@ST  8@0 @@0D@d0  8 X0$HX08$ H `'  % 0L@@D  0L@@D@D 0L@@D    0L@@D@ 0L@@D  0L@@D0@@@D -X 0@80<@@D p8X0L $HX0@8$ H  80P`8P<`X0$8 H   @0P `8P<`@D   0I@ @D    0@@ @D 0@0D@X0$8 H8X0$ H@' 0@@ @D 0L @D 8 X0$H8@X0$ H  0L@ @D 0@@ @D   0L@ @D  0L@ @D @ 0L@ @D  0L@ @D 0-@L8X0 $H8PX0 $H<#38X$ L0 -(0Lp 0HS꼞77X77P0S6$0& 8X0 $HV>0$X8 La/DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0S0p -L bP  9 -pLP`U  |(R00L0P@h0TX`800 \0l X$8 H0 `h 9:9 -LMX 0@@D 80<@p8X0 $, H0 8 X0$HX08$ H  80P`8P<`8X0$ H   @0P `8P<`@D (K  0I@ @D   0 0  & 0@@ @D  0L @D ,0@0D@0@@ @D 0L @D 0@@ @D -(0Lp 0HS P777@7P0S($0& < DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0S p -L =P D9 -pLP`0  tQ00L0P@` 0T X`800\0X$8 H0 `hD9:89 -X0@ 80<@@D p8X0L $HX0@8$ H  80P`8P<`X0$8 H  0@@P`p 8< @pD  )@0P`@PD`    @0P`@PD`0@0D@8 X0$H8@X0$ H@P갧7H7H7H77H7H7H7H7H7H7H7h7H7H7H7D7H7H7H7 7,@0P`@PD`,@0P`@PD`,@0P`@PD`,@0P`@PD`,@0P`@PD` -@Ld8X$ 0L -(0Lp 0HS ꤨ7ب7@77P0S($0& /.DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L P 耆9 -pLP`  tO00L0P@` 0T X`800\0X$8 H0 `hYꀆ9:t9 -X 0@80<@@D p8X0L $HX0@8$ H  80P`8P<`X0$8 H   @0P `8P<`@D   0I@ @D    0@@ @D 0@0D@8X0$ H "  0@@ @D  0L @D 0@@ @D 0L @D 0@@ @D -(0Lp 0HS H7|7787P0S($0& DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L P 褆9 -pLP`  tN00L0P@` 0T X`800\0X$8 H0 `h0꤆9:9 -X 0@80<@@D p8X0L $HX0@8$ H  80P`8P<`X0$8 H   @0P `8P<`@D   0I@ @D    0@@ @D 0@0D@8X0$ H0@@ @D  0L @D   0@@ @D 0L @D 0@@ @D -(0Lp 0HS 777Ա7P0S($0& eDL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sfp -L P 9 -pLP`  t^M00L0P@` 0T X`800\0X$8 H0 `h 9:9 -X0\`@80<@@PD`p8X0L $HX08$ H   80P`8P<`  0I@P` P`@PD` 0@P`@PD` @P` \0, 0@P`@PD` 70LP`@PD`P`UV8 X0$H8@X0$ H  @0P`@PD`   0@P`@PD`0@P` @PD` L0P`P`@PD`P`U0@P`@PD` -(0Lp0BS777Զ7P0S8$0& 0S 8X0 $HX98$ L W%DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0S&p 0- @L8X0$HX98$ LP}U X0$8 H P8 X0$H@ R\ &RZ \0`0B%S&D7H7H7H7H7H7H7D7H7H7D7H7H7H7H7H7H7H7H7H7H7H7H7H7H7H7H7H7H7H7H7H7H7H7H7H77D7 &R& 0X$8 L8 X0$HXp08$ L@0&S 8X0 $H:89X$ L0 < X0$8 HPX$8 0LT -L P 9 -`LpP  K00L0P@1T08 0XP?>C2@0 0 \ $ L@0 SA S T0X$8 H0 ` X0$8 Hdh\0  8X0 $HX@8$0 L8X0 $H=8$X= L0X$8 L\0 X0$8 H0 S@09X$8 L@09:9 -@L=8X$ 1<L -(0pL0DL`0P&\ P0S lKX X X $0& p: -P`LpJ00L0P@0T80XP00\04 000 ThJ X0$8H  `hg: 9: - 0LP@@P 0 3@5,  S R ? :Z -L M$ X 0@0, 80<@@Dp8X0 $4 HX0@8$ H0   80P`8P<`X0$8 H   @0P`8P<`@D(K  0I@@D  0  0@@@D40@0D@8 X0$HX0@8$ H    2 0L@@D0L@@DD,@P ,0 @P!8X0$X H! 0@@@D0L@D 0L@@D8X0$ H 0@@@D@ 0L@@Dr  0L@@Dg:hD: -(0L$`PL0@%S P0S PJZ Z Z  [$0& 0@ 8X0$H $0&S X0$@L`8P0 6/0X$8 LT: 0- 0@ LdPcP 00 3@5 ? 0I?P  D?P00$9hD:: -LP`p?P!  I00L0P@p 0T Xp8000\0X$8 H0 `hH$9:9@: -X 0@@D 80<@pX0L $8H   80P`8P<`X0$8 H   @0P `8P<`@D   0I@ @D  0@0D@8 X0$H8@X0$ H 0@@ @D  0@@ @D   0L @D 0@@ @D 0L @D p-@L8P$`X0 L@H0 4/p -(0Lp 0HS 7(777P0S($0& [ZDL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L P l9 -0L `3 LPPp) 0P?> S0T0  G00L0P@ Xp8 T0\X$8 H0 `hx?( T 0 3L`9l9:T9 -(0Lp 0HS 77d77P0S($0& ^,DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0S-p -L _P 蜈9 -pLP`R  t%G00L0P@` 0T X`800\0X$8 H0 `h꜈9:9 -X 0@@D 80<@pL8X0 $HX$8 H  80P`8P<`8X0$ H   @0P `8P<`@D   0I@ @D     % 0@@ @D   0L @D 0@0D@0@@ @D 0L @D 0@@ @D -@L$8X 0L8X$ 1<L -(0Lp 0HS l777\7P0S($0& }|5DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L 6P 9 -pLP`)  tE00L0P@` 0T X`800\0X$8 H0 `h9:9 -X 0@80<@@D p8X0L $HX0@8$ H  80P`8P<`X0$8 H   @0P `8P<`@D   0I@ @D    0@@ @D 0@0D@8X0$ H0@@ @D @ 0L @D 0@@ @D 0L @D -(0Lp 0HS 77x77P0S($0& a`DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L P 9 -pLP`  tD00L0P@` 0T X`800\0X$8 H0 `h9:9 -X 0@80<@@D p8X0L $HX0@8$ H  80P`8P<`X0$8 H   @0P `8P<`@D   0I@ @D    0@@ @D 0@0D@8X0$ H 0@@ @D   0L @D 0@@ @D 0L @D -(0Lp 0HS L777<7P0S($0& EDDL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L P 89 -pLP`  xC00L0P@d 0T X`8000\0X$8 H0 `hn89:,9/ -(0Lp 0HS 77d77P0S($0& ^,DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0S-p - 0pPL`3C 0?.C""+C00L0P@ T8 0 3B5<0 X`?.B"@ 00\0X$8 H0 ` `0 d0  h4hBX0$8 Hd::P9: -@L@0S8X0 $H08X$8#8 L8X0 $H 08X$8#8 L8X0 $H08X$8#8 L8X0 $H$0 08X$ L -LMX0@|80<@@pD8X0 $0 HX0@8$ H,   80P`8P<`X0$8 H   @0Pp`8P<`@pD(K  0I@p@pD  ,  0@@p@pD00@0D@X0$8 H0@@pp@pD0Lp@pD0@@pp@pD gL0P`p@pD -(0Lp 0HS 7 7t77P0S($0& "!DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L P h9 -pLP`  A ?.B"@ 00L0P@ T8 X`0 \0l X$8 H0 `hFh9:\9 -X0@ 80<@@D p8X0L $HX0@8$ H  80P`8P<`X0$8 H  0@@P`p 8< @pD  )@0P`@PD`    @0P`@PD`0@0D@X0$8 H8X0$ H ) 0 > ,@0P`@PD`8 X0$H8@X0$ H    ,@0P`@PD`,@0P`@PD`,@0P`@PD`@ ,@0P`@PD` -0BLp S77D787DL`0P&P 4P0S1$0& ~MDL`0P&P P0SDL`0P&P P0Sjp8X0$ H8;X$ L -L P 9 -pLP`  xS@00L0P@d 0T X`8000\0X$8 H0 `h9:ԉ9 -LMX 0@80<@@D p8X0 $, H8@ X0$HX08$ H  80P`8P<`8X0$ H   @0P `8P<`@D   0I@ @D     & 0@@ @D   0L @D , 0@0D@0@@ @D 0L @D 0@@ @D -0BLp S74777DL`0P&P 4P0S1$0& d3DL`0P&P P0SDL`0P&P P0SPp8X0$ H8;X$ L -L sP 49 -LM Pe  8?00L0P@0T80X0 \0l  X$8H0\  ``0  mL hP0L`p 0pL 8PLl0 p`0  49:(9 -LMX0@80<@@Dp8X0 $0 H8 8 X0$H4 X0$8 H,   80P`8P<`X0$8 H *  0I@@D , 48 0 - ,0 SK S0 S0@@@D,E0L@D  @0P`8P<`@D(K0 0@0D@0@@@D @0@D X0$8H  8@@@D0@@@DL0P`@D@ -(0Lp 0HS ,7`777P0S($0& MLDL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L P p9 -`LpP  =00L0P@0TXP800 \0l X$8 H0 `X0 $8H 0 `;``@0:` d0 h]X0$8 Hdp9:d9 -LMX0 Sp, > 0@80<@@D !8X0$HX0@8$!H  80P`8P<`0S  8P`0@0X!X1X0P!N=X0$8 H  , 0@0D@ ! <=8 X0$H8@X0$ H   0@@ @D  0L @D 0@@ @D 0L @D 0@@ @D ,c7:P9:9: -2LM, Qp@'(0 , 0BS787 77D`L0P&P 'P0S$$0& ,TP!<(0h$P L0@ %S  D`L0P&P P0SP0S$0& 0 @P8 X0$HX0@8$d H@hPh0l 0Sh0T0h@p,c:97 -Lp`Pb<0 R&00L0P@0T80X`0 0l \04 000 lhH< X0$8H  `h 3<:,c9:̊9: -0 3B5L  (0:2P ? : -@0LSpD0S8X$ 0L$8X :LX$84 L$@8PX0 L`H; 6/8X0 $H:8$X#: L$8X 0L$8X 0L$8X 3LX$8: L$@8PX0 L`H; 6/$@8PX0 L`H; 6/8X0 $H:#:$8X: L$8X 2L$8X 2L$8X =LX$8w0 L8X0 $H:#:$8X : L$8X X2L$8X @2L$8X (2LX$8< L8X0 $H:#:$8X : L$8X 1L$8X 1L$8X =LX$80 L8X0 $H:#:$8X: L$8X 1L$8X 0L$8X 0LX$8< L$@8PX0 L`H; 6/$P8@X0 L`H; 6/$8X 0L(h|e A` -L@mh 0-@0LSP D0S@8 X0$H@ 0T00T0$X8 ;LG: -@LT0` \0,B# 0<8X $L-8X <$L$8$  d0U(K$P L0@%S < DL`0P&\ R 8 X0H8;X$ LDL`0P&P P0S D0R 80RF 0 R00 P0S$0& 0@@ :/PX0$8l Hh0l 0Sh00h0pP0S$0& T08 X0$H@P 0ێPv< 0ST888(888`888888888888:,0 0LA0S@ T> 0@S S+ 08$X L, $<8X L0X$8 L#T  `, @ , X0$8 H ~ h@T P`0@0 0@S , 堀,, T  hD: -L P 9 -pLP`  _800L0P@0T08 0$?>C2@0 X` D 0 0l \0 BH0 ` `0 d0  T0X0$8 Hd9:܊9 -L P 00 0Q400P 0- PL004D@m0 p-LPML0`SP Q S 0R h@KP,0+8L0 0( 5KPLPKpLPh@KPp,05KLP (P LP -L@ 004400 p-LPMhPK@`PK,@005KX0(0 0+8L0 0( 5K P@0H0#80Kp0 p-LPMhPK`@P$,L0L 0SD0# (0 0L 5KnPH0[#SKp#0 0-LPMd@KPP, 0$0 04KSK0 p-LPMhPK@`P+L 0L0 70R5K08L0 ;(0 9PH0  0Kp 0-`0 SL@\ dP0 0 v`0S<Q 800(: -h0L@\J7L P00Q00S 0$ $ hNh;@BOc0:0 8 0-T@LTP+  @T @0 [P@0  P \6 @TTP P 006@00P:8: -@0L@T0S06T0SJ@0h: < -@L _p  @ !! 0-@00L4004PP x60 004PP @v68QLPP@0 6 PP:: 0-@0L P  0@0TP @T0T P0X T0H00@0@0 0-P@LT@0 0@0P ,60h]P p6P @0 0@00h, 6,@0@0::9 0-L00P4 P @0 00@00h1@0 0@@0~x@000@0@00 0- PLU@0V 0R0 0000h0 0 0h臽 p-PL@A00h  h0`@0hd0 Pphot0S/l -L`#\0PSdp ZPd@T0  \0S E@0\0s@0 0@0\ @\0s @`@: -@L ` 0P hO508L: Q0-L@ Q 0h@0P0\00Pd0 0-L M0P@@YEx(50 E HKX5000 4 80@0 D 00 <0   0 P4T0d X0h 0 l0 Tdtxp@@a@00@01K0hXt40  d40  T40 D4<44K0h4:2:8d8<8:::(::0: -0L*p3 80R/00  ( ,100 !0 $1(!/(!:L:T:d: p- 0LP44`1>@0S@ V40`S@}4!1|w4t r4 Q \m4Hphj4Lh410 ` b4V$]4l:::2::0: ::: -0@PPDL  p  ` -LM4 0Pp\2*@R`4  <)4(KYS4 P4`P@g PP PPh T1 !T TPYWP,P ,@P0 U 0 0f P0 @  P!0P XP, 0B P`Y4 P3`P`P@PD@P@yPD`@40LP3`40 (03 ro:::::/ p-`L @PT Q  @PT400$phA00 R/0S/ -LPMQp0@0Π; ; pK$PP `';00 501Q 91710U 01-1 '1@`"1@1S1@P 1\ SXE \ 1U\ L1@P00X9::4:<:::P9@::|9$: p-0L@`,P'Pp 0p: p-LMT@`T 0 PKSf% 0@ % @TKp"8$8 p-P@PLP`p@v0! _?0P@(@ @ @T : 0P(  Tp<pܶ9g p-@LPI`P x0000pX0 R @Tp4004 p@TpH:ca p-L@0`0P Q0000pP` X0 `X APH0SpP0 00P0X0PH RXp *0000p\:t: 0-LM@00@0 K@oP @00@00 @00@0">P@0H0@00 400 0 4P P 4/0 DP0  /0::0@-P@< <(4"4 ,!<$ 0!$@,, T< N0 -LPMP@`P $KtpKPP$<180 @` < ҁ0P4X0 0KX 40 D P@0@ 5[S P/$0+84  X0 %K|PT0  P$<40  05KlP  -LMpPo1[S ,`p,`kda004(`P \y,^ 004 `PLe ::',: : N:d:H:: -LPM`p )PP` l@KP @"0` P0 @30, 8P 4@ 0@ 5K`P  K  P p-LM@0@0@0PK@ 0S#@ P004P `P p0PqPQ Pp0@0pp -LM0`K@ !<( 4"4,!< $ $"#4p0 ,0 4@\ 0 00aP0cS0c^t@P@0\ 0 00aP0cS0c^T@0Pt1(@\ 0 00aP0cS0c^T@0x1 K -LLM00@p4 PP,`KPP w+ 004x PP `i+$K iPPD0 x1;t1SD1  lK 0PPΠ`$\ 0 00aP0cS0c^`h&h  0PP 0 L#+@+O`P  +Pa:P,: ::: 0-L@PP @0 0ho0h -@0L` Pp@\ 0 00aP0cS0c^T@0PH1`@\ 0 00aP0cS0c^T@8#8@L1XP\ 0 00aP0cS0c^T@PQP@\ 0 00aP0cS0c^@pQH@\ 0 00aP0cS0c^t@PRq@@\ 0 00aP0cS0c^T@pSQ8@\ 0 00aP0cS0c^t@0PTqU10@\ 0 00aP0cS0c^T@0pX1 @\ 0 00aP0cS0c^t@ P\q @\ 0 00aP0cS0c^T@:#:`14!RA8A8\E8\E8\E8)P`@\ 0 00aP0cS0c^T@4pH1X@\ 0 00aP0cS0c^t@PPqP@\ 0 00aP0cS0c^T@pQQH@\ 0 00aP0cS0c^t@PRq@@\ 0 00aP0cS0c^T@pSQ8@\ 0 00aP0cS0c^t@PTq0@\ 0 00aP0cS0c^T@pUQ(@\ 0 00aP0cS0c^t@0PVqW1 @\ 0 00aP0cS0c^T@0PX1@\ 0 00aP0cS0c^T@4\1 P @\ 0 00aP0cS0c^T@0`1Pp@\ 0 00aP0cS0c^T@0PH1`@\ 0 00aP0cS0c^T@8#8PL1X@\ 0 00aP0cS0c^T@pPQP@\ 0 00aP0cS0c^t@PQqH@\ 0 00aP0cS0c^T@pRQ@@\ 0 00aP0cS0c^t@PSq8@\ 0 00aP0cS0c^T@@TQ0P\ 0 00aP0cS0c^T@0UQ@V1 P\ 0 00aP0cS0c^T@\Q\: -@0L0P`v@ Pv@\ 0 00aP0cS0c^T@ RP0!6 @\ 0 00aP0cS0c^T@zP'z'@\ 0 00aP0cS0c^T@0 0#P8!H@\ 0 00aP0cS0c^T@@PL @\ 0 00aP0cS0c^T@:#:D1~\ 0 00aP0cS0c^T@ 0BS0!Pr@\ 0 00aP0cS0c^T@0P416 @\ 0 00aP0cS0c^T@zP'z'@\ 0 00aP0cS0c^T@0 0#P8!H@\ 0 00aP0cS0c^T@@@AP004DT@0Q<y8!81R &400@&0@00(P\ 0 00aP0cS0c^T@4505 81@x:: -LPM`ppKP#100 05Ks<P& P$@0KT RH @ 08R#HP@ PKYP6P0pSPP X0 dWPX T@T#000 @T P 05K0,8T0 0 3P PKGPY AP @T K@,&0:-40 ^ 1 <18 R80_ 0-P@LT0$0 0(00h% 0-@L㋬0p 0RP0 h"0h輭 -PL @40p`q0  04  QP0(0i螭04  w -p`TL Pyx0@h0l`p@t@D@  0`00y0 m hmP8P8 -L\MP04 S@p0 0(0ᭀ(K0`6K GKu-K pA  k0@H1S= ESI pS= S  S> S7     X1@K %: B00K 0yK~K}0KK  qK  aK :R: #P @ 0 }  x::::::: -`Lp㟫0S R0000 0 @PϬ@@@宭@00 `h葭 p-`PL᝭@T R0000 0   zp -@LP j00 p- P@L0Pp`0 0 ``Od d0{U 0@     \0pT8DT8 p-@LT`pPP PPP 6P   00p -LM` <P @7 TQ Rʨ0  QpP L$ ޽ ڽK0P 0:$@K 3sH`DP0< $ P@ !$@?$:TX8P8Ԇ2@: p-LMP4@0 \ 1 `R 0S 0(0Kp(005SX8X8X8X8X8X8X8X8;HFS0eC=Gry=iG}<;~G݊<<РD3h&ǂLǠ6 %?aextent_freepool_p_freepr_find_pageheadpool_do_getpool_init@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????U0'z'}'d{'%|'{'%${'z' M'%z'|'('H'l'''"("(!(!(,"(L"(Hs8n; &C vkkMPG&"֊/aK+d 5ӆ1 q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,PPPPPPPP999999999999 999,989@9H9P9X9\9d9h9l9p9ieee80211_newstate:t9h:3x90 9G(|99$9!90890d9409`9RD9UL9p9T9|9 95|9X9R999796O:7t979 999729979697(996 90,9@9X9!T996\95h\9t,:7x`9d9p9l 9R`97|979A9H9C9J9K 999@9I9 9E$9E(9,9094959897H:7<9:@9`:0'D9H9!L9P9.T9X97B97*\9"̥:O`9\ 9`d9Jh9h97vl9lD97Xp9zt9(:x9|9:79B97X9695:9E9696 909G$9:97H9Z9E\9:^ :V9w9979@@@ @@ !" 1:7 25@608 943 @ A BC D@EFGHIJ K RSTU V X`abcdefgh ij9T9U9S9R99F9I9V9E99G 9(9B0989X@9H9DP9T9 \97d9@l95t9|929699890999994999 939h9@999 9"9 9!$9,9:49<91D9L9HT9@`9Jh9Kp9Ax99C9 99@999f9g9`9a9b9c9d9e9i9j999arpresolvearp_rtrequestigmp_init}E#(DoKgpqrstuvwxyz*T**8*PQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(IKy xZݨ31Y'_`QJ -zɜ;M*q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,: @6؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~                               A@@@A@@A@@@@A@@@A@@@@@@AAA@@@@@@@@@@@@@A@@A@@A@@@A@A@@A@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                                        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\Z H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*Fexpand 32-byte kexpand 16-byte k?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@,p,ԙ,x,\,,,,ȑ,T,,|,p, ext2fs_blkfreeext2fs_dirbadentrym-p,(d-x,\,0b-`-[-Z-0Y-s-XY-p,-\-`-4-9-$-9h-d-9uao_find_swhash_eltHc$cHcOcOcOcHcivmmapbsy\icmp6_reflectnd6_resolvend6_rtrequestnd6_lookupnd6_initnd6_na_outputnd6_ns_output0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs-1(1(1 (1(#1 (#1(#1 (#1 (#1 (#1::::: ::,:<::   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c            (08@P`p   0@`  0@`gg_bus_dma_busaddr_to_paddr!iT#:L9 !i\#:L9)iT#:L9 )i\#:L9-iT#:L9Aid#:9 -i\#:L9PAl#:9pA|#:9A#:9A#:9/A#:9?A#:9A#:9A#:9/A#:9?A$:9OA$$:9A8$:9AH$:9/A\$:9?Ap$:9OA$:9A$:9A$:9@A$:90A$:90A$:9pA$:9pA%:9A%:9A$%:9A8%:9H%:P%:X%:l%:h%:t%:|%:|%:%:%:%:%:%:%:%:%:&:&:$&:4&:D&:T&:`&:l&:x&:&:&:&:&:&:&:&:&:&:&:&:&:T&:`&:l&:x&:&:&:&:&:&:&:&:&:&:&:&:&:':':':': ':(':&:&:&:&:&:&:&:&:&:&:81):1):81):1):̻1*:(*:̻1@*:`*:̻1x*:*:̻1*:*:̻1*:+:̻1 +:@+:@````` ```t6:6:6:6:6:6:6:6:6:6:7:7:(7:47:D7:P\:X7:x7:7:7:7:7:8:8:@8:\8:8:8:x;:8:8:9:(9:H9:l9:9:9:9:9:9:::4::d::::::;:,;:`;:;: ;: ;: 0<: l<: <:<:=:P=:p=:=:=:>:4>:d>:>:>:?:,?:H?:p?:?:?:?:@: ,@: D@: \@: p@: @: @: @: @: @: A: ,A: `A: A: A: A: B:  B: PB: xB: B: B: B: C: (C: HC: hC: C: C: C: D: D: PD: lD: D: D: D:D:E:0E:LE:`E:E:E:E:F:\e:>e:>e:>e:>e:?f:?0f:?Hf:?hf:?f:?f:?f:?f:?g:? g:? ,g:? Lg:? `g:? xg:?g:?g:?g:?g:?g:?h:?0h:@Lh:Alh:Bh:Cj:Dh:Dqh:Ei:Fi:G4i:GHi:Ghi:Gi:Gi:Gi:Gj:G0j:H`j:Ij:Jj:Kj:Kj:Kj:K k:Kk:K,k:K@k:K\k:Llk:Nk:Pk:Pk:Pk:Ql:Ql:RLl:S\l:Sxl:Sl:Sl:Sl:Sm:Sm:S8m:STm:Tlm:Um:Um:Um:Um:Um:U n:UHn:Uhn:Utn:U n:U n:U n:Wo:X8o:YTo:Zho:Zo:Zo:Zo:[o:[p:[p:[4p:\Pp:\dp:\|p:]p:]p:]p:] q:]Tq:]q:]q:]q:],r:]`r:]r:]r:]r:],s:]`s:]s:]s:] t:]!8t:]"pt:]#t:]$t:]%u:]&Lu:]'u:](u:])u:]* v:]+Tv:],v:]0v:]1w:]2680~9o:k;lL|=>@ApD FPQSTXY] dK2 G9<x44P4Hr4q4ABCDEFGHIJKLMNOPQRSTUVWXYZ㡱vt100444<444@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_#@[\]^_`{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!:::::::ȹ:й:ع::::: :(::::: :(:0:8:@:D:H:L:P:T:X:\:`:d:h:l:p:t:888xM5d]5 U5\54:H:T:h:t:|:::::::ȿ:Կ:ܿ::::::X f(  pt""(4I@@@@1` #U3UCU4QF              @@@@@@@@@@@@@@@@@@@>@$@eaQ@X@W@@0@ w@Q2@U@4@F s%^^H555H555t5@5D5@5D5p55=xX9RZ9 [9][9d\9]9I^9l_9J|_9R`97`9 "a9 Na9 ^a9 a9Ka9(b9@#2b9(b9(b9(b9(b9(b9 (b9(b9H@(b9 Nxb9 _c9c96e9\f9 g9 g9 g9Eg9 8/?9:;<=>?@ABC D E FG HIJK,L.MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.eh i jklmnopqrstuvwx yz{|}~ mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= aAkK~xX}iIpP& eE ,; c d tsrqQ'?ljbB|oOuUv.:yY{!\"12< 3>!(4[")5]#@6$+7%-8&/9'*0, _-=^.%`/z0w123n4m5$#6gG7h8fd/ 2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7./[{E%0]}J*3;:64'"M-6,<17.>N.8/?Q aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7.--_V.=+T/[{E%0]}J*1\|W2\|W3;:64'"M-5`~6,<17.>N.8/?Q eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4eE a`~}kj!1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%//.{0wW}1qQ|2qQ|3sr4"5`~6   7fF 8\ qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? 1IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;3_^4i05"678.:d<>| /1,;`2,;`3_^'aAcCeElLBAnNDCoOsS[ZxXzyzZ|{ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKBlLAmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/a`01~}2~}3  456,;<7.:>8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcC  eE gG#" iI+*kK76lL<;nNFEoOMLsSa`uUkjzZ~} cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'`eEqQ@2"#6&$7/{%8([&9)]'0=}-\.-_/0'?~1+*`2+*`3456,;7.:8d<>| 4^    `5 5 5554555h55dd55dd5(I*LBCDOMPJQNRK(I*LCDEOMPJQNRK55P5D5$5h5<555(  2 v      W 1 Q `  5@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   <5  L+ L 5L2 D   O  {5o  A f F  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n@n n@n @nn@0Df @  * Q k k"k"k"k"k @^z BF 9 |565 B  w *w +w +~ W UP  < 1b0 0rk {&"79n= wF@W wn a-  6| 66  JK0 r*6t56>6TF6TP6W6$$0$0$$$$$$$$$$$$$$ $ e6e6l6@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 04|6{6z62V{%1" `"'`~%ZP `,6t6d60w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-666hF F hF fF 6$6̾6006686X666url_int_miibus_writeregurl_int_miibus_readreg@@9WP P Q@ R667:5g hahh! !(3P@3vK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-   Pp < %dcould not requeue I/O%s: sr_wu_enqueue_ccb got active wu%s: sr_wu_init got active wu%s: invalid target on wu: %p%s: i/o error on block %lld target %d b_error %d unknown optional metadata type%02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02x%s%s%s: %s: %s: invalid chunk state transition %d -> %d%s: sr_startwu_callbacksr_schedule_wu: work unit not in progress (state %i) sr_sync%s: invalid optional metadata checksumunknown old optional metadata type %u %s: no in memory copy of metadata %s: could not allocate metadata scratch area %s: could not write metadata to %s %s: save metadata failed OPENBSDSR %s%03dsr_shutdownsr_down%s: roaming device %s -> %s %s: sr_scsi_cmd NULL discipline%s: %s device is being deleted, failing io %s: wu %p not on pending queueunable to allocate work unitsunable to allocate ccbsvolume %s not foundcould not allocate memory for metadatacould not allocate memory for foreign metadata%s: sr_rw: failed to allocate vnode %s: I/O error %d on dev 0x%x at block %llu failed to get DUID for softraid volumeinsufficient boot storagefailed to write boot blockfailed to write boot loadercould not save metadata to %s%s: sr_meta_rw: invalid metadata pointer cannot clear foreign metadatanot enough memory for metadata buffercould not read native metadatanot part of the same volumenot all chunks are of the native metadata formatsrc_dev_mm == NODEV%s%d%cdiscipline does not support rebuildrebuild already in progressvolume not degradedno offline chunks available to rebuildno online chunks available for rebuild%s: sr_rebuild_init: can't allocate vnode %s partition not of type RAID (%d)%s: %s partition too small%s: %s partition too large%s partition too small, at least %lld bytes required%s partition too large, wasting %lld bytes%s sector size too large, <= %u bytes required%s is already in userebuild of %s started on %s%s: no offline chunk found on %s! %s: %s volume degraded, will attempt to rebuild on hotspare %s sr_hotspare%s: pending I/O failed to complete on failed chunk %s, hotspare rebuild aborted... %s is already a hotsparesr_hotspare: cannot allocate vnodeHOTSPAREcould not save metadata for %sunsupported state request %dchunk not part of arrayinvalid foreign metadatanot valid softraid metadatainvalid metadata checksumcannot read metadata version %u on %s, expected version %u or earliersr_meta_native_bootprobe: cannot allocate vnodenot enough memory for fake disciplinesr_meta_native_bootprobe: cannot allocate vnode for partitionnative bootprobe could not read native metadatasr_meta_probe: cannot allocate vnodesrdiscould not create discipline taskqcould not initialize disciplinechunk %s already in useinvalid metadata formatdisk %s is currently in use; cannot force createfailed to clear metadataone of the chunks has corrupt metadata; aborting assemblychunk sizes are not equal; up to %llu blocks wasted per chunkvolume level does not match metadata leveldisk %s already assembledtrying to bring up %s degraded%s was not shutdown properly%s is offline, will not be brought onlineno free target for %sscsi_probe_lun failedvolume %s is roaming, it used to be %s, updating metadata%s volume attached as %ssdwd%s: failed to allocate boot volume %s: failed to allocate device array %s: failed to allocate ondisk array %s: failed to allocate hotspare %s: found duplicate chunk %u for volume %u on device %s %s: not all chunks were provided; attempting to bring volume %d online sr_locksr_hs_lock%s: controller registration failed%s: bogus rebuild restart offset, starting from 0 %s: resuming rebuild on %s at %d%% %s: could not create read io %s: could not create write io sr_rebuild%s: could not save metadata to %s sr_yieldsoftraidsr_concat_rw%s: %s: too many ccbs queued %s requires two or more chunksCONCATsr_crypto_rwcannot open key disk %s%s is not a key diskCRYPTOKEYDISKunknown crypto algorithmunable to allocate CCBsincorrect key or passphrase%s requires exactly one chunksr_raid0_rwinvalid strip sizeRAID 0%s: retrying read on block %lld %s: sr_raid1_intr_cb%s: permanently failing write on block %lld sr_raid1_rw%s: is offline, cannot read invalid volume state%s: %s: invalid volume state transition %d -> %d %s: %s: %s: invalid chunk state transition %d -> %d RAID 1%s: permanently fail write on block %lld sr_raid5_rw%s: %s failed to get read work unit%s: is offline, can't read %s requires three or more chunksRAID 5sr_raid6_rw%s: can't get wu_rDisk %llx offline, regenerating Dx+P Disk %llx & %llx offline, regenerating Dx+Dy +Q singleDisk %llx offline, regenerating Dx%s old_state = %d, %d = %d, invalid new_state%s requires four or more chunksRAID 6RAM diskfictitiousrdattach: out of memoryrd%drdattach: device name too long%s: insufficient message buffers %s: %s /mnt/etc/firmware/%s%s: device enable failed : failed to clear NIC buffer at offset %x - check configuration , address %s dp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d RRIP without PX field? SPIEEE_1282IEEE_P1282RRIP_1991ARRIP with incorrect NM flags? RRIP with incorrect flags?isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] cd9660_vget: alien ino_t %lluCD001%/@%/C%/Ecd9660_mountroot: can't setup bdevvp'scd9660root_devicetag VT_ISOFS, isofs vnode cd9660_strategy: spec%s(%d): W^X binary outside wxallowed mountpoint OpenBSD#!/dev/fd/%d/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedzerothreadfork zerothreadscheduler/sbin/init/sbin/oinit/sbin/init.bakbqquiesbqqueuebqwaitbqdestbufq_init: type %i unknownbufq init failbqinitinitclocks: unable to register softclock intrfdlockfileplfdescpldup2: fdallockqreadkqueueplknoteplwaitinit died (signal %d, exit %d)thrdeathcpu_exit returnedprocprocessppwaitunable to allocate kthread_qWARNING: thread `%s' (%d) exits with status %d %d,malloc: allocation too large, type = %d, size = %lu malloc: out of space in kmem_mapmallocarray: overflow %zu * %zuphysiochgproccnt: procs < 0procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplplimitpl%s/%s%s(%d): syscall %d "%s" %s(%d): sysctl %d: %d %d %d %d %d %d ni_pledge/tmp//etc/localtime/var/run/ypbind.lock/dev/null/dev/tty/etc/spwd.db/etc/pwd.db/etc/group/etc/netid/etc/resolv.conf/etc/hosts/etc/services/var/yp/binding//usr/share/zoneinfo//etc/malloc.confaudiochowncpathdnsdpathdrmfattrflockgetpwinetmcastpfprot_execpsrecvfdrouterpathsendfdsettimestdiotmppathttyunixvminfovmmwpathprotexeccpu_switchto returnedfork idleidle%dsensorssensorsuspendpauseissignal sigaplsigwaithashinit: bad cnt%s:%s,sysctllksysctldlkthrsleep%s%s(%d)Timecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %lld.%09ld to %lld.%09ld dummynanosleepdenied attempt to set clock forward to %lld denied attempt to set clock back %lld seconds boredunexpected %s tq state %dunable to create thread for "%s" taskq unexpected %s tq state %utqdestroysystqsystqmpsrpfinipreempt: cpu_preempt not yet implementedsetrunnablefailing resume cannot be handled resume %s config_mountroot: can't allocate defer structureconfig_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structureautoconfconfig_detach: forced detach of %s failed (%d)%s detached config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %s>>> probing for %s* mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe %s at root%s at %sroot device %s not configured not configured unsupported %02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx/dev/%s%s%ccannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs use one of: exit %s[a-p]dkopendisklabels not read:root device (default %sswap device (default %s%s)root device (%s) not foundnetbootroot on %s%ccan't figure root, hope your kernel is right (%s.%c) swap on %s%d%c dump on %s%d%cdisk_unbusy: %s: dk_busy < 0 disk_detach: disk_count < 0dklkdisk_attach: can't allocate storage for disklabelwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)extnt%s: start 0x%lx, end 0x%lx %s: region not foundextentpl klog<%d>klog: dropped %ld byte%s, message buffer full <%d>sendsyslog: dropped %d message%s, error %d%s: %s: page empty%s: %s free list modified: page %p; item addr %p; offset 0x%x=0x%lx != 0x%lx%s: %s: page header missing%s: %s: incorrect page%s: %s free list modified: page %p; item addr %p; offset 0x%x=0x%lxphpool%s: too much uptimepoolsdma%d0123456789abcdef%llo%llx(null)0123456789ABCDEFbug in kprintf: bad base%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %skernel %sassertion "%s" failed: file "%s", line %d*FOUND**UNKNOWN*%ld0%lo%3d free slot (for add) %3d %s count %d disable (pseudo device) Unknown devno (max is %d) %3d at ??? %s flags 0x%x %s [] ? Unknown argument command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know--- more --- %ldError unknown state already enabled %3d can't enable free slot %3d %s disabled %3d can't disable free slot already Unknown routine /%c/ Value missing for attribute Unknown attribute change (y/n) ?out of memory. flags changed %3d can't change free slot count%3d %s changed Unknown pseudo routine /%c/ %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d disautoconf verbose %sabled Unknown command User Kernel Config UKC> Continuing... addchangedisableenablefindhelplinesquitshowtimezoneverbose?pollselectpipeplpipelkpipeclpiperdpipewrttckoutqload: %d.%02d not a controlling terminal no foreground process group empty foreground process group runningrunnableiowait cmd: %s %d [%s] %lld.%02ldu %lld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d m_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLmbuf prepend length too bigmbufplmtagplmcl%dkm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufWARNING: mclpools limit reached; increase kern.maxclustersrequested tag size for pool %#x is too bigm == NULL in m_pulldown()soaccept !NOFDREF: so %p, so_type %dnetclssoclose NOFDREF: so %p, so_type %dsockplsbcreatecontrol: message too large %d sbdropsbappendcontrolsemi-panic: sbcompressnetiosbsndlsbrcvlsbappendaddrnetcon2netconacceptunp_connect2unp_attachuipc 1uipc 2uipc 4piusrreqinconsistent bufpage countsbiowaitbufplbiodone alreadyneedbuffernobuffersbuf_get: dup lblk vp %p bp %pgetblkuvm_pagealloc_multi unable to allocate an buf_object of size %lubuf_needvabufinit: can't reserve VM for buffersnchplwtf? leak?vop_generic_revokeallnameilf_findoverlap: defaultlockfplrelookup: null namerelookup: lookup on dot-dotbrelvp: NULLbgetvp: not freevflushbuf: not dirtyvflushbufvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvwakeup: neg numoutputsoftdep %d vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing aliasvgonel: not cleanmissing bdevvgetvnodevfslockunmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done vnodesuvmvnodessyncer vnode syncermount: lost mountunmount: dangling vnodeNon dma reachable buffer passed to VOP_STRATEGYvn_lockspec_badop calledspec_ioctltag VT_NON, dev %d, %d spec_close: not specialspec_fsync: not dirtyspec_fsyncspec_read typespec_write typechkvnlockdead_badop calleddead_write: lockdead_read: locktag VT_NON, dead vnode dos2unixtime(): month value out of range (%u) detrunc(): can't truncate root directory, clust %u, offset %u deextend: file too largedenodedeget(): pcbmap returned %d extendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath(): .. not a directory? msdosfs_sync: rofs modRRaArrAatag VT_MSDOSFS, startcluster %u, dircluster %u, diroffset %u (LOCKED) dev %d, %d, %s msdosfs_strategy: specmsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_write(): bad file typebpfattachbpf_mcopybpf: ifpromisc failedbpfbpfszunhandled af %difa_update_broadaddr does not support dynamic lengthegressifihrmifidxrmtoo many interfaces%s: can't handle af%d allsoftnetunable to create softnet taskqifqbarlooutput: no header mbuflo%dunable to create lo0loifmedia_add: can't malloc entryifmedia_set: no match for 0x%llx/0x%llx ifmedia_set failedrtmaskcannot initialize a radix tree without memoryfailed to initialize the mask treern_delete: inconsistent normal annotation rn_delete: inconsistent mklist refcount rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation rn_delete: couldn't find our annotation Mask for route not entered rn_addmask: mask impossibly already in tree %s %p at %p rn_delete: Orphaned MaskNon-unique normal route, mask not entered raw_usrreqactive node flags=%xrt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 ifafreertfree: %p not freed (neg refs) rt_timer_init: already initializedrttmr%s RTM_RESOLVE: wrong ifa (%p) was (%p) rt_timer_timer: rtq_count reached 0 rt_timer_queue_destroy: rtq_count reached 0 rtentryroute_init rtable_addroute_outputunexpected mode %uunexpected mode %d%s: invalid channel freq %u flags %x %s: invalid channel (NULL) Bad IBSS channel %u%s: bad channel ignored; freq %u flags %x number %u Pairwise key expansionPMK Name%s: Michael MIC failure %s: %sassociation failed (status %d) for %s %s: received %s from %s rssi %d mode %s 80211scanfreeing bss nodeunable to setup inital BSS nodepassive%s: end %s scan %s: begin %s scan invalid group data cipher!invalid integrity group cipher!management frame too large: %unull node%s: sending %s to %s on channel %u mode %s %s: no node for dst %s, discard raw tx frame %s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: received msg %d/%d of the %s handshake from %s group key4-wayEAPOL-Key frame too large: %u%s: sending EAPOL-Key request to %s %s: sending msg %d/%d of the %s handshake to %s %s: open authentication failed (reason %d) for %s "0x%s: no recent beacons from %s; rescanning %s: bogus xmit rate %u setupassociatedsynchronized%s: %s with %s ssid channel %d start MCS %u.5 start %u%sMbshortlong protection enabled HT enabled %s preamble %s slot time%s%s assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocauthdeauthactionaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11b11g11naeamatauazbebgbhbnbobrbybzcacncocrcyczdodzegf2fifrgrgthkhnhrhuiqisj1j2j3j4j5jmjojpk2kekpkrkwkzlbliltlvmamkmomxmyninlnzpaphpkprpyqarusasgsisvtntrtttwuaukuyuzvnyezazwAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLDarp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp%s: bad gateway value: %s %s: pool get failed %s: %s: route contains no arp information %s: %s: incorrect arp information %s: no mbuf invalid argument to in_lifaddr_ioctlin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportIPv6 pcb passed into in_pcbconnectinpcbplinternet%u.%u.%u.%uicmp_do_exthdr: m_getptr failureicmp_erroricmp lenipqeipqip_initaeshmac-sha1deflaterip_attachrip_detachrip_usrreqsyncachetcp_pulloutofbandm_pulldown malfunctiontcp_output REXMTtcp_outputtcpcbtcpqetcp_inittcp_usrrequdp_usrreqipip_input: should never reach herecryptocrynlkcryptopcryptodesccuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_apply: len %d < 0cuio_apply: off %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for lenSoftware crypto device cannot initialize!3DESBlowfishCAST-128Rijndael-128/AESAES-CTRAES-GCMAES-GMACAES-XTSCHACHA20-POLY1305HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512GMAC-AES-128GMAC-AES-192GMAC-AES-256DeflateLZS1.2.3start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodedev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u uid %u on %s: %s bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapmode = 0%o, inum = %u, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free dev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimfile system full %s: write failed, file system is full ffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeffs_truncate: newspaceffs_update: bad link cntsoftdep_flushfiles calledffsinodino1plffs_vget: alien ino_t %lluupdate: rofs modffs_statfsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_reload: dirty1ffs_reload: dirty2WARNING: soft updates isn't compiled in ffs_mountroot: can't setup bdevvp's ffsffs_fsync: not dirtyffs_fsyncffs_write: nonsync dir writeffs_write: typecheckpath: .. not a directory First bad Second bad %s: bad dir ino %u at offset %d: %s bad dirufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_ffs_size too smallufs_strategy: specufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entrychown: lost quotaifree: range: dev = 0x%x, ino = %u, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodebad block %u, ino %u %s: freeing free block: dev = 0x%x, block = %u, fs = %s mode = 0%o, nlinks %u, inum = %u, fs = %s ext2fs_valloc: dup allocext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapcg = %d, ipref = %u, fs = %s ext2fs_nodealloccg: map corruptedext2fs_nodealloccg: block not in mapext2fs_indirtrunc: bad buffer sizecheckpathrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%u, rec_len=%d, name_len=%d i_size too smallext2fs_direnter: newblkext2fs_direnter: frag size%s: nonsync dir writeext2fs_write%s: typeext2fs_vget: alien ino_t %lluext2fs: wrong magic number 0x%x ext2fs: wrong log2(block size) %d ext2fs: zero blocks per group ext2fs: wrong revision number 0x%x ext2fs: first inode at 0x%x ext2fs: unsupported incompat features 0x%x ext4fs: only read-only support right now ext2fs: your file system says it needs recovery ext2fs: unsupported R/O compat features 0x%x ext2fs_statfsext2fs_reload: dirty1ext2fs_reload: dirty2%s: file system not clean; please fsck(8) ext2fs_mountroot: can't setup bdevvp'sext2fsext2inoplext2dinoplext2fs_mkdir: blksizeext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled diruvm_addr_invoke: address selector %p (%s 0x%lx-0x%lx) returned unavailable address 0x%lx sz 0x%lxuaddruaddrhintuaddrbestuaddrpivotuaddrrnduaddr_rnduaddr_hintuaddr_kbootstrapamap_splitref: split at zero offsetamap_splitref: map size check failedamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_populate: offset out of rangeamap_lookups: offset out of rangeamap_lookup: offset out of rangeamap_unadd: offset out of rangeamap_unadd: chunk for slot %d not presentamap_unadd: nothing thereamap_wipeout: corrupt amapamapplamappl%damapchunkplamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countanonpl%s: can't allocate entryuao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsuao_detuaoeltplaobjpluao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_getpageuao_getudv_faultudv_detachudv_attachuvm_fault_unwire_locked: address not in mapanonget2flt_noram1fltamapcopyflt_noram3flt_pmfail1fltagain2flt_noram5flt_pmfail2uvm_init: page size not setkm_allocvauvm_km_pgremove_intrsafe: no pagekmallockmthreadvallocwaitkm_alloc1wkm_pgrmuvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_init: could not reserve space for kernelkm_free: unmanaged page 0x%lx uvm_map_clean: weird flagsuvm_mapent_addr_removeuvm_mapent_addr_insert: entry still in addr listuvm_mapent_addr_insert: map %p entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx) insert collision with entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx)vmspplvmmpeplvmmpekpluvm_map_splitentry: split address 0x%lx not on page boundary!uvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries vmmaplkuvm_map_protect: kernel map W^X violation requesteduvmspace_fork: no space in map for entry in empty mapfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)uvm_share: encountered a submap (illegal)uvm_share: non-copy_on_write map entries marked needs_copy (illegal)uvm_map: kernel map W^X violation requested%s(%d): %s W^X violation mprotectmmapuvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_setpagesize: page size not a power of twouvm_pglistallocuvm_pglistalloc: Upper boundary 0x%lx not on pagemask. uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_inituvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in initsize 0 uvm_pagereallocpagersegpgdaemonuvm_wait emergency bufbackoff pagedaemon: deadlock detected! pagedaemon: wait_pla deadlock detected! pmrwaituvm_wait: failed to free %ld pages between 0x%lx-0x%lx uvm_pmr_split: lost one pmr Flags: 0x%x, will panic now. pgzerowarning: resource shortage: %d pages of swap lost swapdrum_addsw_reg_strategy: swap to sparse fileswstrategy: vnode type 0x%xswap_off: swapdev not in listswap0x%04xdisklabel reserve/dev/%s%d%cblkdev0x%xuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswplksbrk: grow %ld failed, error = %d uvm_deallocate with null mapuvn_iosyncuvn_cluster: offset out of rangeuvn_flshuvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_attachuvnsyncuvn_getpageuvn_getNULL pointer passed to ip_ecn_egressNULL pointer passed to ip_ecn_ingressin6_prefixlen2mask: invalid prefix length(%d) in6_are_prefix_equal: invalid prefix length(%d) in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: failed to remove a route to the old destination: %s invalid argument to in6_lifaddr_ioctlin6_ifawithscope: output interface is not specified %s: got interface identifier from itself %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_notify_error: in6_embedscope failed sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.c%s: source can't be determined: dst=%s ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%u) ENOBUFS in icmp6_error %d icmp6_mtudisc_callback_registerip6_nexthdr: m == NULLip6_input: packet to an unready address %s->%s ip6_initcannot forward from %s to %s nxt %d received on inteface %u cannot forward src %s, dst %s, nxt %d, rcvif %u, outif %u assumption failed: hdr not splitndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt unspec%s: failed to lookup %s (if=%s) %s called more than once nd6ln->ln_rt == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)%s: %s: route contains no ND information %s: something odd happens %s: %s: incorrect nd6 information ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrndp info overwritten for %s by %s on %s %s: failed to join %s (errno=%d) %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_ns_inputnd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found ???nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: multicast adv without TLLA nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p defrouter_select: more than one router is installed defrtrlist_del: negative count on %s nd6_rs_input: invalid hlim (%d) from %s to %s on %u nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) rip6_attachrip6_detachrip6_usrreq invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versioncompatiblestatusreginterrupts: no device tree #address-cells#size-cellsmodel: unknown model cpurangesmainbusnamephandlelinux,phandleNo support for this CPU type (%08x) in kernelUndefined instruction in kernel real mem = %lu (%luMB) avail mem = %lu (%luMB) Warning IRQ's disabled during boot() WARNING: not updating battery clock _bus_dmamem_map: size botch_bus_dmamap_sync: mix PRE and POST%s: curaddr %#lx not in range_bus_dmamap_sync: ARM32_BUFTYPE_INVALIDunknown buffer type %d _bus_dmamap_syncProcessor failed probe - no CPU ID %s %s (%s core)%s: DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s: %dKB/%dB %d-way %s unified cache %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. unknown CPU (ID = 0x%x)PXA250PXA210PXA27xARM Cortex A5ARM Cortex A7ARM Cortex A8ARM Cortex A8 R1ARM Cortex A8 R2ARM Cortex A8 R3ARM Cortex A9ARM Cortex A9 R1ARM Cortex A9 R2ARM Cortex A9 R3ARM Cortex A9 R4ARM Cortex A15ARM Cortex A15 R1ARM Cortex A15 R2ARM Cortex A15 R3ARM Cortex A15 R4ARM Cortex A17ARM Cortex A17 R1ARM Cortex A35ARM Cortex A53ARM Cortex A53 R1ARM Cortex A57ARM Cortex A57 R1ARM Cortex A72ARM Cortex A72 R1ARM Cortex A73unknownXScaleCPU_XSCALE_...CPU_ARMv7wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**step A-0step A-1step B-0step B-1step B-2step C-0rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step ?step C-5rev 0rev 1rev 2rev 3rev 4rev 5badaddr: invalid size (%lu)userkernelFatal %s mode data abort: '%s' trapframe: %p DFSR=%08x, DFAR=%08x (imprecise), spsr=%08lx Fatal %s mode prefetch abort at 0x%08lx trapframe: %p IFSR=%08x, IFAR=%08x, spsr=%08lx r0 =%08lx, r1 =%08lx, r2 =%08lx, r3 =%08lx r4 =%08lx, r5 =%08lx, r6 =%08lx, r7 =%08lx r8 =%08lx, r9 =%08lx, r10=%08lx, r11=%08lx r12=%08lx, usp=%08lx, ulr=%08lxssp=%08lx, slr=%08lx, pc =%08lx Fatal abortUVM: pid %d (%s), uid %d killed: out of swap data_abort_fault: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x, 0) -> %x Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)mmrwpmap_map_chunk: no L1 table providedpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_alloc_specials: no l2b for 0x%lxpmap_bootstrap: No L2 for L2 @ va %ppmap_init_l1: can't get PA of L1 at %pCannot allocate L1 KVMCannot allocate L1 physical pagespmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmapplpvepll2dtblpll2ptpplxscale_setup_minidata: can't find L2 table for VA 0x%08lxpmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_enter: failed to allocate L2 bucketpmap_enter: no pv entries dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vunmapbufvmapbufglassattempting to switch console to lcd screen ffuartbtuartstuartbootfile: %s bootargs: %s unknown option `%c' cpu not recognized!%08lx -> %08lx @ %08lx OpenBSD/zaurus booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx Allocating page tables freestart = 0x%08lx, free_pages = %d (0x%08x) initarm: out of memoryinitarm: Failed to align the kernel page directoryIRQ stack: p0x%08lx v0x%08lx ABT stack: p0x%08lx v0x%08lx UND stack: p0x%08lx v0x%08lx SVC stack: p0x%08lx v0x%08lx Creating L1 page table at 0x%08lx Mapping kernel Constructing L2 page tables freestart = 0x%08lx, free_pages = %d (0x%x) switching to new L1 page table @%#lx...bootstrap done. init subsystems: stacks vectors undefined page pmap Attempting to power down... The operating system has halted. Please press any key to reboot. rebooting... reboot failed; spinning Diagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02xCDBParametersError in %s, Offset %d, bit %dActual Retry Count: %dProgress Indicator: %dprobe%s(%s:%d:%d): %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO: 0x%x (VALID flag %s) COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s DEFERRED scbusyunknown error category (0x%x) from scsi driver scsi_done called twice on xs(%p)unexpected xsh state %usyncxspendxsscsiiomvscsi_xfer pool exhausted! scxsplscsiplugscsi_cmd_rw_decode: bad opcode 0x%02xNo Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataDefects In Error WindowError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - LBA Marked Bad By Application ClientAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBLogical Unit Not SupportedInvalid Field In Parameter ListThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_T Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_T NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedORWrite Generation Does Not MatchOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleiSCSI IP Address AddediSCSI IP Address RemovediSCSI IP Address ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureATA Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorPHY Test Function In ProgressSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid SA UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated DeviceXS_SHORTSENSE scsibus at %sscsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUdirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEvendor-unique targ %d lun %d: <%s, %s, %s> ATAPISCSI%dremovablefixed %d/%s %s%s naa. eui. t10. serial. wwn._ offline: %d targets, initiator %d, WWPN %016llx, WWNN %016llx%s: unable to register bio scsibusPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14ATAPI CD-ROMSCSI CD-ROMcdNEC CD-ROM DRIVE:260SCSI opticalSCSI disk%s %s(unknown)%s: %lluMB, %lu bytes/sector, %llu sectors, thin, readonlysoftintr_establish: unknown soft IPL %d addr 0x%lx intr %dWARNING: using filesystem date -- CHECK AND RESET THE DATE! pxa2x0_probe_sdram: impossiblepxaip_attach_critical: failed to attach INTC!pxaip_attach_critical: failed to attach GPIO!pxaip_attach: failed to map CLKMANpxaip_attach: failed to map RTC: CPU clock = %d.%03d MHz pxaippxa2x0_io_bs_free(): not implementedpxa2x0_io_bs_alloc(): not implementedcouldn't establish interruptirq %dintr_establish: bogus irq number %dintr_establish: can't malloc handler info: Interrupt Controller stray interrupt %d pxaintcpxagpio_reg_write: not bootstrappedpxagpio_reg_read: not bootstrappedpxa2x0_gpio_set_intr_level: bad level: %d%s: unhandled GPIO interrupt. GPIO#%d %s: failed to hook main GPIO interrupt pxa2x0_gpio_intr_establish: Pin %d not GPIO_IN: GPIO Controller %s: Can't map registers! pxagpioclock%s: Cannot map registerspxaostendpoint %d already used by %cfifo full when trying to set short packet pxaudc_read_epN: ep %d, no xfer ep%d: fifo error : cannot map mem space : USB Device Controller : unable to establish interrupt usbc: unable to establish connect interrupt pxaudc%s: init failed, error=%d %s: Unknown depth (%d) : failed to map registers %d%s: unable to establish interrupt at irq %d%s: battery life expectancy %d%% %s: AC off,on,backup power,unknown, battery is highCRITICALchargingundecoded (%x)bogus new frequency 0 for rate %d maxclock %d pxa2x0_apm_sleep: can't map OST pxa2x0_apm_attach_sub: failed to map POWMAN apmlk%s: failed to map CLKMAN %s: failed to map MEMCTL %s: can't map GPIO %s: failed to create kernel thread, disabledapmevapmpcmcia_function_enable: function not initializedpcmcia_function_init: function is enabled, (manufacturer 0x%x%sproduct 0x%x function %d "%s: error %d detaching %s (function %d) pcmcia_card_attachpcmciapcmcia_parse_cis_tuple%s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecifiedmulti-functionserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus Adapterunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx%s%lx; memspace@ %lx%s%lx%s%lx; maxtwins %d; mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: CIS checksum failed %s: using CIS quirks for SVECFD605 PCMCIA EtherNet CardV1-1%s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase %s: can't alloc mem for enet addr %s: can't map mem for enet addr : unexpected I/O space configuration : can't get subregion for asic : function enable failed : can't map NIC I/O space : can't map ASIC I/O space port 0x%lx/%d: can't match ethernet vendor code , %s: no suitable config entry AmbiCom IncAMB8002TPMX PE-200DIGITALDEPCM-XXPCMCIAUE2212D-LinkDE-660DE-660+RPTI LTD.EP400CISV100RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212ETHERNETW89C926Seiko Epson Corp.P/N: EEN10B Rev. 00CNetCN40BC EthernetNE2000FastEthernetLNT-10TNNDC004743118001TAMARACKGVCNIC-2000pR01Ethernet CardiPort10/100 Ethernet CardFast-EthernetETHER-C16Fast EthernetPCMCIA LANCF10Base-EthernetLinksysEtherFast 10/100 Integrated PC Card (PCM100)Ver 1.0DE-650I-O DATAPCET/TX-RDFE-670TXDLINKSYSE-CARDPCLAcorega K.K.corega Ether PCC-Tcorega Ether PCC-TDcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDSMC8041TX-10/100-PC-Card-V2XircomCompactCard EthernetCFE-10: can't map first i/o space : can't map second i/o space port 0x%lx/%lu,0x%lx/%lucannot allocate channel queue : %s: can't handle card info Digital Mobile Media CD-ROMPortable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI Adapterwipwr: can't alloc i/o space : can't map i/o space %s: can't establish interrupt %s%s Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11ISL37300PWLCFL-11INTERSILHFA384x/IEEEVersion 01.02SMC2632WNANOSPEEDNECWireless Card CMZ-RT-WPVersion 01.01NTT-ME11Mbps Wireless LAN PC CardAddtronAWP-100 Wireless PCMCIACabletronRoamAbout 802.11 DSIntersilPRISM 2_5 PCMCIA ADAPTEREval-RevASymbol TechnologiesLA4111 Spectrum24 Wireless LAN PC CardPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN AdapterAllied Telesis K.K.WR211PCMpxapcic_mem_map: bogus kindpcic_attach_card: already attachedpxapcicevpxapcicss%s-%d%s: unable to create event thread for %s : %d slot%s pxapcicmmclk%s: data not a multiple of %d bytes mmcmd%s: unsupported bus frequency of %d KHz : can't map regs mmccd: can't establish card interrupt : can't establish MMC interrupt : MMC/SD/SDIO controller sdmmc%s: can't attach bus pxammclcdzkbdwd0: failed to map %s : PCMCIA/GPIO controller scoopscoop_pcic_set_power: bogus power statescoop_pcic_write: bogus registerscoop_pcic_read: bogus register%s: invalid CF slot %d%s: can't map memory %lx for scoopscoop_mmc_set_power: unsupported OCR (%#x) zssp_read_ads7846: not configured zssp_ic_send: invalid IC %d : can't map bus space zsspapm_acapm_bczts%s: standby command didn't complete %s: standby command timeout %s: standby command: drive fault %s: flush cache command didn't complete %s: flush cache command timeout %s: flush cache command: drive fault ST506wd_get_params: bad return code from ata_get_paramswddump: try againwddump: polled command has been queuedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: %swddump: unknown error typeST506/MFM/RLLESDI/IDE disk__wdstart: bad return code from wdc_ata_bio()device faultdevice timeout, retrying %s: soft error (corrected) %s: IDENTIFY failed : <%s> %s: %d-sector PIO, LBA48, %lluMB, %llu sectors LBA, %lluMB, %llu sectors CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors %s: enable look ahead command didn't complete %s: enable write cache command didn't complete %s: freeze lock command didn't complete %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: not ready, st=0x%b, err=0x%02x wdc_ata_ctrl_intr: state==RECALpiomodedmamodegeometrysetmultirecal%s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq error not notifiedno media/write protectedaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorinterface CRC erroraddress mark not foundtrack 0 not foundbad block detectedwd0aboot device: lookup '%s' failed. boot device: %s wswaitwswait2wsdisplay at %s%s: screen %d-%d added (%s, %s emulation) wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsrestorewsdisplaytty() on ctl device%s: screen %d deleted dmuxwsdisplay_common_attach: no memory mux %d: console (%s, %s emulation), using %swsdisplaywsevent_read%s: connecting to %s %s: disconnecting from %s wskbd at %s%s: can't attach mux (error=%d) %s: event queue overflow wskdetwskbd_detach: %s didn't detach cannot load keymap %s: cannot load keymap, falling back to default %s: console keyboard%s: attach error=%d wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmouse at %s attach error=%dwsmouse_set_param: invalid parameter type wsmdetwsmouse_detach: %s didn't detach wsmousewsmux_getmux: no memory for mux %d wsmux: attach out of memory wsemul_vt100_output_c0c1: ESC in kernel output ignored [>24;20;0cP2$u\P0!u%5\[?62;6c[%d;%dR[?13n[?21n[?27;1nOIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOC[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~[35~[36~[37~[38~OPOQOROSOpOqOrOsOtOuOvOwOxOyrasops_init: fontwidth assumptions botched!rasops_init: font table is empty rasops_init: couldn't lock font fontwidth not 8/12/16 or RASOPS_SMALL - fixme!wsfont_unlock: font not lockedno usable key codes array%s: was console keyboard usb at %sendtaskusbatskusbtskunable to create usb abort task threadusbtaskunable to create usb task thread%s: root hub problem %s: root device is not a hub usbpalock: USB revision %s, not supported %s: can't register softintr pre 1.01.12.03.0usbusbd_desc_iter_next: bad descriptor usbd_desc_iter_next: descriptor length = 0 usbd_desc_iter_next: descriptor length too large usbd_start_next: error=%d usbd_transfer: not doneusbsynusbrefusbdetusb_detach_wait: %s didn't detach out of dataiface desc0 lengthusbd_fill_iface_data: bad descriptor(s): %s usbdly%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config %d at addr %d failed %x.%02xvendor 0x%04xproduct 0x%04x"%s %s", class %d/%d rev addr %d port %d configuration %d interface %d%s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS portNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%s: connected port %d has no power %s: port %d reset failed %s: device problem, disabling port %d %s: illegal enable change, port %d %s: port error, restarting port %d %s: port error, giving up port %d %s: hub depth (%d) exceeded, hub ignored %s: unable to set HUB depth %s: no ports, hub ignored %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: cannot open interrupt pipe %s: port %d power on failed, %s uhubuhidev_intr: bad repid %d uhid at %s reportid %d%s: could not read endpoint descriptor %s: unexpected endpoint %s: no input interrupt endpoint %s: no HID descriptor %s: no memory %s: no report descriptor %s: iclass %d/%d, %d report id%suhidevuhidrea: input=%d, output=%d, feature=%d uhidukbd%s: got polled xfer %p, but %p already pending %s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Unknown state %d%s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %d bytes instead of %d bytesBulk-OnlyCBICBI with CCIISD-ATARBCSCSIUFI%s: using %s over %s %s: isdata not configured %s: command protocol=0x%x not supported %s: bus attach failed umass%s: Unknown status %d in umass_scsi_cbumass_cmd: large datalen, %d %04x%04x%s%s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: open intr pipe failed: %s %s: aue_send error=%s %s: usb error on tx: %s %s: watchdog timeout %s: %u usb errors on intr: %s %s: no memory for rx list -- packet dropped! %s: %u usb errors on rx: %s %s: reset failed %s: close rx pipe failed: %s %s: close tx pipe failed: %s %s: close intr pipe failed: %s %s: tx list init failed %s: rx list init failed %s: MII read timed out %s: EEPROM read timed out auemii%s: couldn't get endpoint descriptor %d %s: missing endpoint %s: address %s aue%s: usb errors on rx: %s axe%d: close rx pipe failed: %s axe%d: close tx pipe failed: %s axe%d: close intr pipe failed: %s axe%d: usb error on tx: %s axe%d: watchdog timeout axe%d: rx list init failed axe%d: tx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s %s: media change failed axe%d: write PHY failed axe%d: read PHY failed axemii%s: couldn't get ep %d no valid PHY address found, assuming PHY address 0 AX88178 AX88772B AX88772 AX88172axerxeof: too large transfer invalid buffer(pkt#%d), continue checksum err (pkt#%d) axen%d: write PHY failed axen%d: read PHY failed enable auto detach (0x%04x) unknown uplink bus:0x%02x axenmii%s: not supported usb bus type AX88178a AX88179axen%d: close rx pipe failed: %s axen%d: close tx pipe failed: %s axen%d: close intr pipe failed: %s axen%d: usb error on tx: %s axen%d: watchdog timeout axen%d: rx list init failed axen%d: tx list init failed axen%d: open rx pipe failed: %s axen%d: open tx pipe failed: %s axen%s: warning: Failed to write register 0x%0x %s: warning: Failed to read register 0x%0x %s: warning: failed to read SMSC_COE_CTRL (err=%d) %s: warning: failed to write SMSC_COE_CTRL (err=%d) %s: warning: failed to read initial AFC_CFG, error %d %s: warning: media change failed, error %d %s: warning: timed-out waiting for reset to complete %s: warning: timed-out waiting for phy reset to complete %s: warning: failed to set the MAC address %s: warning: failed to read HW_CFG: %d %s: warning: failed to read HW_CFG: (err = %d) %s: warning: failed to read ID_REV (err = %d) %s: warning: failed to read MAC_CSR (err=%d) %s: error: smsc_chip_init failed (err=%d) smscmii%s: warning: MII is busy %s: warning: MII write timeout %s: warning: MII read timeout smsc%s: cue_send error=%s %s: read MAC address failed %s: setting config no failed %s: getting interface handle failed cue%s: kue_send error=%s %s: warm boot, no firmware download kue%s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: usb error on rx: %s %s: too many errors, disabling %s: open interrupt pipe failed: %s %s: close interrupt pipe failed: %s %s: extra ethernet descriptor %s: no data interface %s: no descriptor for interrupt endpoint %d %s: interface alternate setting %d failed %s: no descriptor for bulk endpoint %d %s: could not find data bulk in %s: could not find data bulk out cdce%s: udav_send error=%s udavmiiudav%s: upl_send error=%s upl%s: ugl_send error=%s %s: bad header (length=%d) %s: bad packet count (%d) %s: bad packet size(%d), length=%d ugl%s: url_send error=%s %s: %s: bad register %04x urlmii%s: failed to get interface, err=%s %s: couldn't get endpoint %d url%s: reset never completed %s timeout waiting for OOB control %s: timeout waiting for OOB control uremiiver 4c00ver 4c01, unknown ver %02xwiusbthrwitxlwiIDLwi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet %s: %s error=%s wiTXsyncUGH TX UGH RX write_record buf size err %x %x invalid packet len: %x memsz %x max %x %s: %s: error=%s %s:%s: invalid packet id sent %x %s: already detached %s: open pipes failed wi_usbRT5222RT2522RT2523RT2524RT2525RT2525eRT2526%s: could not retrieve Tx statistics - cancelling automatic rate control %s: could not write MAC register: %s %s: could not read MAC register: %s %s: could not write to RF %s: could not read BBP %s: could not write to BBP %s: timeout waiting for BBP %s: could not read EEPROM: %s %s: could not allocate protection frame %s: could not transmit buffer: %s %s: could not allocate rx mbuf %s: could not allocate rx mbuf cluster %s: could not allocate rx xfer %s: could not allocate rx buffer %s: could not allocate tx xfer %s: could not allocate tx buffer %s: timeout waiting for BBP/RF to wakeup %s: could not allocate AMRR xfer %s: could not open Tx pipe: %s %s: could not open Rx pipe: %s %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor for iface %d %s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s uralset config activated %s: can't create task thread %s: can't establish softintr %s: usbf_new_device failed, %s usbf%s %s, rev %d.%02d/%d.%02dusbf_start_next: %s encap error cdcef_do_request %s: usbf_transfer failed OpenBSD.orgCDC Ethernet Emulation: usbf_add_config failed : usbf_add_interface failed : usbf_add_endpoint failed : usbf_add_config_desc failed : usbf_end_config failed : usbf_alloc_buffer failed : usbf_open_pipe failed : usbf_transfer failed : address %s cdcefOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_detach: phyloc and offloc specifiedmii_attach: phyloc and offloc specifiedmiiautmii_phy_setmedia: MASTER on wrong media: %s, rev. %d nsphyDP83840 10/100 PHYnsphyterDP83815 10/100 PHYDP83843 10/100 PHYDP83847 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYi82562G 10/100 PHYiophyi82553 10/100 PHYeephy88E1000 1 Gigabit PHY88E1000 2 Gigabit PHY88E1000 3 Gigabit PHY88E1000 4 Gigabit PHY88E1000S Gigabit PHY88E1011 Gigabit PHY88E1111 Gigabit PHY88E1112 Gigabit PHY88E1116 Gigabit PHY88E1116R Gigabit PHY88E1118 Gigabit PHY88E1149 Gigabit PHY88E3016 10/100 PHY88E3082 10/100 PHYPHYG65G Gigabit PHY88E1000 5 Gigabit PHY88E1000 6 Gigabit PHY88E1000 7 Gigabit PHYexphy_service: can't isolate 3Com PHY: 3Com internal media interface %s: ignoring this PHY, non-zero instance xlexphyrlrlphy_service: attempt to isolate phy: RTL internal PHY rlphyRTL8201L 10/100 PHYRTL8201E 10/100 PHYIP101 10/100 PHYlxtphyLXT970 10/100 PHYLXT971 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphy80220 10/100 PHY80225 10/100 PHY84220 10/100 PHYtqphy78Q2120 10/100 PHY: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present ukphybmtphy3C905B internal PHY3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHYnsgphyDP83861 10/100/1000 PHYDP83865 10/100/1000 PHYDP83891 10/100/1000 PHY%s: %s: enter down%s: %s: link %s : RTL internal phy urlphyrgephyRTL8169S/8110S/8211 PHYRTL8251 PHYmmcdiemmcdly%s: i/o init failed %s: mem init failed %s: can't identify card %s: can't supply bus power %s: can't supply clock %s: can't enable card %s: no functions mmctsk: 8-bit: 4-bit: 1-bit, sd high-speed, mmc high-speed, dma%s: can't create DMA map SpectecSDIO WLAN CardSDW-820%s: CIS version %d.%d SDIO%s: bad CIS ptr %#x %s: CIS parse error at %d, tuple code %#x, length %d %s: bad CISTPL_FUNCID length %s: bad CISTPL_MANFID length %s: CISTPL_VERS_1 too short %s(%sat %s%s: can't read CIS %s: can't set I/O RCA %s: can't select I/O RCA %d %s: can't supply voltage requested by card %s: can't send I/O OCR %s: can't read EXT_CSD %s: unknown CARD_TYPE 0x%x %s: can't change high speed %s: can't change bus clock %s: can't re-read EXT_CSD %s, HS_TIMING set failed %s: can't switch to DDR %s: can't switch signalling voltage %s: SD_SEND_SCR send failed %s: can't change bus width %s: switch func mode 0 failed %s: switch func mode 1 failed: group 1 function %d(0x%2x) %s: unknown MMC version %d %s: unknown SD CSD structure version 0x%x %s: unknown MMC CSD structure version 0x%x %s: can't set mem RCA SandiskToshibaMicronSamsungKingstonSD/MMC%04X%s: can't allocate ccbs %s: can't attach scsibus Pjd'({^~: 9 9(9$9,949<9H9P9\9`9h9p9x9,:|9999999 /10-)('&K% !$" 64;; ;;NcNc ;;OcOc ;;ococ ;;ococ$ ;;ocpc$ ;;$pc8pc ;;@qcTqc ;;hqc|qc ;;qcqc ;;qc;, ;;qc;< ;;qc;L ;;sc\; ;;xucduc$ ;; zc ;$ ;; zcl ;$ ;; zc ;$ ;; {c{c ;;{c{c ;;<|cP|c ;;<|cP|c ;;h|czc ;;|ch{c ;;|c|c ;;|c8sc ;;}c}c ;;4}cH}c$ ;;}c}c\ ;;<~c(~c\ ;;ccd ;;Q9c ;;T9c ;;T9c ;;U9c ;;$U9cX ;;+Dq9HcX ;;+q9\c ;;(y9c ;;z9c ;;\z9c ;;z9Ģc ;;z9c ;;{9c ;;|9 c ;;(9 c ;;9\'}WǠ}WǠhEAIW׾ IW׾ IW' a~yDJW5NW#y}WǠpx .lWuO*lW/lW/b0(lW|iE0lW[ 5lW[ 5i˻hlW5mWmW _!pC mWJ#mWJ#mWJ#install.sub mWUT'mWUT'mWUT'install.subUy mWs*mWs*mWs*install.subqfc>ʺZ^k}#y<v:"SV+ Vc`U(B:%2Iܑn6dՈ3yATύoISɢt)]3"*Օmf%=[̭-dTU|n )R/FWҺy&vK V|#vcx4KUo8݋ɀnej]Q& +A"ȔZzK\]K c8MI˵mc]g0ra{;:˂9QAa`>K>C %WSZkY)ۆuk>1ԤehPgqx݆L`t I7? ]ML J=ġp+C_+CM䋡k ~0 d:z#b,F? Лn_[\Y,yv {&2˳L\pߏH~D1^{6{"8)`URJd X-t|AG"D1ʋ~OTV BPs 380 W“d  ... export VNAME=$(sysctl -n kern.osrelease) export VERSION="${VNAME%.*}${VNAME#*.}" export ARCH=$(sysctl -n hw.machine) export OBSD="OpenBSD/$ARCH $VNAME" export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs rootdisk=$(dmesg | sed -E '/^root on ([^ ]+) .*$/h;$!d;g;s//\1/') if [[ -z $DONEPROFILE ]]; then DONEPROFILE=YES mount -u /dev/${rootdisk:-rd0a} / echo ! : >/etc/rc echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T cat <<__EOT Welcome to the $OBSD installation program. __EOT timeout=false timer_pid= if [[ ! -f /tmp/noai ]] && { ifconfig netboot >/dev/null 2>&1 || [[ -f /auto_install.conf ]] || [[ -f /auto_upgrade.conf ]]; }; then echo "Starting non-interactive mode in 5 seconds..." >/tmp/noai trap 'kill $timeout_pid 2>/dev/null' EXIT trap 'exit 1' INT trap 'timeout=true' TERM set +m exec 3<&1 4<&2 >/dev/null 2>&1 (sleep 5; kill $$) & timer_pid=$! exec 1<&3 2<&4 3<&- 4<&- set +m fi while :; do echo -n '(I)nstall, (U)pgrade, (A)utoinstall or (S)hell? ' read REPLY if $timeout; then timeout=false echo REPLY=a else [[ -n $timer_pid ]] && kill $timer_pid 2>/dev/null timer_pid= fi case $REPLY in [aA]*) /autoinstall && break ;; [iI]*) /install && break ;; [uU]*) /upgrade && break ;; [sS]*) break ;; !) echo "Type 'exit' to return to install." ksh ;; !*) eval "${REPLY#?}" ;; esac done fi  . ..@ bin dev etc mntAmnt2e;sbind;B tmp usrvarinstbin.profile install.md install.sub autoinstall  install  upgrade MDXDM=y md_installboot() { } md_prep_fdisk() { local _disk=$1 _q _d while :; do _d=whole if disk_has $_disk mbr; then fdisk $_disk if disk_has $_disk mbr openbsd; then _q=", use the (O)penBSD area" _d=OpenBSD fi else echo "MBR has invalid signature; not showing it." fi ask "Use (W)hole disk$_q or (E)dit the MBR?" "$_d" case $resp in [wW]*) echo -n "Setting OpenBSD MBR partition to whole $_disk..." fdisk -iy $_disk >/dev/null echo "done." return ;; [eE]*) cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. Inside the fdisk command, the 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} disk_has $_disk mbr openbsd && return echo No OpenBSD partition in MBR, try again. ;; [oO]*) [[ $_d == OpenBSD ]] || continue return ;; esac done } md_prep_disklabel() { local _disk=$1 _f=/tmp/fstab.$1 md_prep_fdisk $_disk disklabel_autolayout $_disk $_f || return [[ -s $_f ]] && return disklabel -F $_f -E $_disk } md_congrats() { val=`ztsscale` case $? in 0) echo grep -v '^mouse\.scale.*$' /mnt/etc/wsconsctl.conf \ >/tmp/wsconsctl.conf 2>/dev/null echo $val "# see ztsscale(8)" >> /tmp/wsconsctl.conf cp /tmp/wsconsctl.conf /mnt/etc/wsconsctl.conf ;; esac } md_consoleinfo() { local _u _d=com for _u in $(scan_dmesg "/^$_d\([0-9]\) .*/s//\1/p"); do if [[ $_d$_u == $CONSOLE || -z $CONSOLE ]]; then CDEV=$_d$_u CPROM=com$_u CTTY=tty0$_u return fi done } ELFa(4,"4 (tttttGZtttۣe RtdLL -L_0! MP@ p-LM@` P MЍ/ 0-dL`M 0 R0   1S0B@Ct1P0 @D03/t0} -404 0LM R @2/ RD}, , 0MS Ѝ/00Ѝ}$ -x@LMp @0S``00T0H 0S 800S 3/$0hd| 8}P p-LM 0P `P dpP 5@POU8 ؐ (4PP ͐E M -LMPP`p 0S h0Q @Q "P 0 i E p-PLM@P`D 0ph-0 M  Ѝ QMЍi 0MЍ/,P 0MЍ/dP -"L<M̂0r"`K@D0C 0Cx ,0 S d'!(Kt xt \tM (4DlL -AMLMt60`h,0 jp PPVp@8 a<oP* aPX AP NPWdP fPRtP+ rP sPJ"vP6 -wPD58D =%@;P0 35$0S(+tP` #X@ P%0S @Ma,P 5@ Pp$H|p40PcAU`c U UYB t`9P`P `~P XyP)0S S  4uP  oPKP fPSP 8 0 !0  0P `1~@PBK@@;`P P@ x0tP 0POU30SBKAAªP @ P B^KPEPPE) ;P@0 C 0  P}@P Ph 04@t00040004 04$}@P }@P}@P P P  P  P LT! 0 0  0z`$10S @<PHP@ 0@@a`0V0X0S ?pP=PP B.K B B"P@ 4P jjp0S9H thlWxtlu tC`t\\<@ PMЍ -LM `E -GMLl1Md1 ANK 0 @D$4 LqL1P`@D oP( !zp0 0bASP AK0 AA4 審P $$AK004 A=KA 0C BPPp -Ph P` A>K 0C0C<$K{ClWpWH t<xT$ -LM@pPg `P 0S nS0oS` = PP00 @3P @Q  0U0P P00 00 X 0000X  TKU 0 00 0Kt0 ?R0S@p0"S8 05K@P(K舤 0Lh -L Mp`P@, P,K0K'  0lP,0S$KMЍ -(0LM0S DuE -0LMp 0p3 P``0PP @@ kP sP aP @h@ P ypL00S <0U8 07 QuCMЍ -LM7MЍr0@-`PM @0 S S 00 ӑR\00 \0Ѝ06- M0S BrЍ -QLM0(  Q: gJ, -LMP`p (K9@0S 0S (00TS#T 0 AJ K< -0LM q QEH -kML M|?0p,0 fp\- B0@3S,T,T| <dt>  h> 1 勘@> PP P $" >b? ?`PU@ 0!0T  PP U0U0T0S I4?`@lP| >@ud=.0T=bP= )@=[ 8=",= $= == <<d.<@ <<<.<6< .K Q0C 0C p  KAP 0SA K@uFPPD ? P``: S00V0S# 0rSU@ ( P@Y 0T  P  P 0?5 X*6: Sh%  S T waK@@@ 9`V' @ P@TDP  pPT D0㔃#aK0NN65 6v v 5 9T9\8 49P 9 @Q R% T905 V\ P Q R Tu/P 00B0R SQR  00B SQ `RpRaPBP0S.S l t300 5S 6S 5S 5SWMK fp`&R= b`P&[ u8PU 9 @@00@0 H00 505 5S05 6S(&g 5S,&_ 5S0p&W %?R5??0 5 &0B R53<3:5Z50S 50S50S50S Z 50S46e   50Si 50S k 6P5 Z0S00 S0 6 5P 0@ P015 13c:3P ]? 4 R 0BX& 40S6 4 R R& (0C\40S 6 p40S d4 R& 40S5 $40S5 40S5 30S6 0p6 v E /NP[NK@D@D6h$ݶP % p  KAP6: SDF@V`p 0 W V8hU 0T&A 0 6S06 ZSf XT3V>V  uZ 6 0<Vv & 6 @ r *0D0 & &F0G@$6@C#&R 3R:Z6XV2 ?v2p@Pk6vC#00W #*Y/ 5S 2将X 5X t2Q &R@F%RH2TE ,2R R % 2R T@F6S Z 'P3T@1F zlxuduTuLuHuEDu@uKR0C6 %6"& A c% Z``0S00S 5S &R X :@X  0 &@L&0ST#3*&Bp&t'6P &0'&X Z%6R X6 # 06V0$!4060 !40!4 06 0!4 0 !40 !405#̠##05###Ƞ0 %$0""Ƞ"$ %@""̠"  !$ !$ )0 `T00S`80 @0 D0v> $ 0@0 (  4 (08Q 0( 0S 00 o0)0$9Q @@T U01U01h5`S X R 0XU0 RaAr1U0!1!!!!!!!C&X030#X0#S bQP6 0 Z0S0 00 V00R:&X:Q (0 0 520#$ 00 0 P B240#$ 0&p% 6P (%0 C Z660X:l+7|+,0 S (KMЍ?MЍ -LM08PKpa@d 08 `'PD 0`'PG p00@TqP`uU<UP 0(0' 0FS,K ӷP@ q,00S xq00(@ ^U 0(P?P@ -P 0(0 0$K      -PLM nBkB|   -L Mp4 :P4 404K00K40 g {PPe 0Sb =r@Pp `cVXnPC000IiV4dP000@ ]P2  00$04lVOP$00 0*oVEP000! >P 00(00S0P00 0  @T@Q0St40S(K    H+    0-LMP 0\).T@00 #. 0<S @yi@J K0h.   $ 0 0~0 +00C -0M000$ Ѝ/0 0~0+0M0-0Ѝ/0S $::  0M0 $ 0Ѝ/0S <<  0M0 0Ѝ/$ @0 0= 0 $ K$0M0  0Ѝ/$@+0MS Ѝ $", 0 0 $Ѝ/ -LM0@S00 K0 _0 0K`t -LM_P>ot 0  -LM_P0nt <  -0LM0  K_P  KtH  -LMIIhY-C0$MЍQ-T  p-LMP@`0 KP 蠏 0S  00Kp\  p-LMP@`0 KP 脏 0S  ֩00Kpd  -LM0@S h;* 0 << 0 p-LM@0 K`P U 0S  娩X]0 0Kpl  p-LM@0 K`P 8 0S  勩n60 0Kpx  MD0Ѝ MD0Ѝ -LM0Pp0`-S000P,K 0,P &%@P 00S `,o0 0 0S0(ozK   MЍV p-LM0LQ`@ LP  00 0 0 0: P0SP 8P  000 00& P0SP $P  $00$0 0$0 P0S`PP  000 00 p P0Sp|   0-LM(P0@S PX000@0putu -LM00CS0 Q l M00-00Q0^   ?00Q@0 0^0 000hu   p-LMh`@PTX0 P+<HP8+0+ +pputuX M -LMRT) p, ` P 0LSDLT\d     + +Pf@tGT +~+Z@ w+@T W @QZ x8 ZX8Z 88 {Z8rZ 7iZ 7`Z 0XZ 7OZ@ |7@FZ  \7 =Z  <7 4ZPP?  +U 6"U 6U 6U 6U  |6 U \6L@U  46 U 6 U@ 5@U 5U  5 U 5 U  t5 U T5 U 45 U 0U4U 4U 4~U 4u@-Up0jUT4aU 44XU@ 4@OU 3FU  3 =U34U 3+@U l3 < S SH  S  S,($ 3 U  3 U 2 U  2 U  2 U 2U `2ZD@R`K 00d"B P@Tr/oq`K Z 0 0S AKdPd0!$0j`0|! VK * *` pQV K)K) ,0 S ((K\lxHX(8HXHxXh 8( @P<     L \   ,    (4  -0LM v QE< -3L`M0 ,0 夣3p x a0@S( (0T p p ]Px  p$#0S`ABUP?U"Mkp2x@K 01x 0 ZP&x{ZPD xZP2W'<HH0S 0Q D=<<Yp0ExKD0t  QXp xKDt DxpK0 K`|Kl0 h0 >P6,P1P,0@000C S1 峊|0@SP 0 (X1 =Pzl j%000 0Ql0S x` KYPh0S x4 KIZPt1 ,0 S X(KlWCCltt@|ht@px gt MЍ - 0LM 0Ӥ] QE -2LNM2\0` 0 @Pp2p"K\d2 A03/P4: S 8(cV02$"2Q0T K A3/P4: SWpPbANK @D@D0!pO  P`1: 0?b,K AP(X10S$P1NKH1P A@! A 2/P48$4R$4R $4R 10S* j%00S PҰ0S00S M l0c\ 0$(P @0 0 S 4Kuuj |uPXxuh -LpM`@hWpTܣfP LP PPA nP sP hP:1P P PP쐟젟pP ip00 cR1P R R 1@KlP  d嘣0: S`  P`PBxxu|uuuC,Q MЍ -LMP(@`p}B@D 0T"X"L"L"L""L"L"L""L""L"L"L"L"L"L""p 0@8P 040 ,0 $0  0P?>>p= -LM*QI7< @@0Pຈ`p 0@0  VUP`Wp(0 4p 0QPK 0QPM  0QPGTQ000ӑ6 -@LM|tld`c T TH@88 ܢfE/H///0X00001T11 -LMp0moK@e/_K 0 e/ K 0 0 x 0 H3e/1 201 2(1 2$1 2d1 2`1  0R K\ " -LM(Q ,Qp.h0Q\ 4Q4 D!h4 80S00, 807< @@00@4 80CW@<Ph4PP4P ( P gPg4``4` ( P tgQp 8p [T g9 @@008@a0000 9 @P@`0`  0g9@@<0P ` 0@VU0g4pp4p p9@p@W0<p `p `P0@XW0g44 88 88 R20P `0`@p 0p`@P@ @@P< 0cg<8p\a W8 40S(K111111(2<2l222203 0-0L M0P0 @ P$0 0 0  00B0 S a0B0SW0BA0B0S70B? K Q02\ 0A@ 0K 0 S H K0 M-L M`0 PP@T t 0 00 0赆@KK0C L0CA8d L4 P T  (Kob(K7747<7@7P7|X7D -  ML00 $3$ B R 3 ! 9 0 4 0 /BCD@EPF`GpA0@  P@ P`p (X0  "X0  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxhpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    h p x x p20S   *bH( <, 00 $8 4 7< @@0 0 7< @@0 01 0@P᣿P0B Y   ͛  a4P @@0 0 P徛4T @@00 ( Მ  ớ@0`l 0CR`V*`PX 塛U P@  ia0Q ( ᑛ  0匛@z T  0@ (KoB}`7h7t7777777D78808H8X8l8888888O9 -LM0S`  0U0S  0MtV pRd2d!`@T( <H, 8<0 404 0$8 ,7< @@0 0 @\0@S  pWpX0 @@00@0M 0@@0 a P0\ P0 @@00P@$ P 0S S1 ښ 0S 0S1  03 ͚ P 00C   l0 |庚p8Y `(Kos999989@9H9P9X9`9l9t9|999999 -L$M,K a0_p 0KGpBCD@EPF`@ A0P@ P`pLpJa밠p`,0aPPP0@@PD,)bP0%bP `V`0,,00S $K|9{9|| p-0LM0008`@00S l wOP\pD0PUp88 hOP(pWEV }gd9edA{6 -3LqM0 (0  8pp :[PP&w w 0᳡됒xp h|凢P XLh&Xo/KOPD妙 KwP6PTP ! ! @ph!`1 >KQ Pl1!`pQ a z?KP`oKQ a `APP0 KV@@`Q將F4@!hQ lq ! oKPP\Pe/oKIPPTU3NA G0S 00CS00PӤ0 '~ BP`0S 00CS00Ӥ0 ~ B PpNUnUl,  (0 S @8$K|% ::@E@rdA6;D;E p-LM`P@P @/e/@\ UVp  phZ; 0-LM D$K8 0K0$@ P ۥp/K0|< -LMXeXu{eP0 RP# EP1 FP< APncP  5TPf?pPE hP3 nPW fP\ vPU wP3 tPU+4 0S 04 H0S 00A0S 0\4  P$4@4  44-,$*00) $0#$0S 0P@P 0S 噘PT#00@ӑ3@#0#00x #^p}@|#0 S0 Pb0Uq ,30S 0SS 30SZ0SVЂCQß 0`P }0S20Sx2@T X200CSP2 R @2QllKp< Y .0ES88"`MPb Kp) U"100CSTPpPPPQPXU oU o-U yKpt2$10S \L|1H 40(oE0ESqP 嚗@0PPD0@0uPP  LPㄗ8u|PPlo]lW|||{|}|(<8<E6 } {P<C}|d<<ledA{pxE@ 68M20 0 "P:Ѝ/@-0@@0` p @ `PpWM 0VUTЍ p- R`L0M0@0 ӑPkR gR. mR tR) 0 + 0"5 ;%"  0g 80@PP00p6C p-LM@@`P0 K%S00d0 o| @T $ \VKp= 0-LMPP0 @@H@T0hC -LM@p@P`` 04P0S  0セP0S 0S0  -0LM`@@0 <@ 80 4@ -,` 0` p@PP0` 8K, Kp8 U 0S *S0@ @K0 Kp( ,0S00S" ,0 ,08K 0#p @@K0 0:P00 0p   $K 0-LMP@0000C00S r 000 ^p@0000C00S r 000"P00 -LM@ p 0P`P4 KiIBT 0@B K|8 -LMP`p1 0@-hD 0$P 0d 0LLL @ T0 0@z>z>>>O9E -LM@dpP` @;T`7< @@`p@`{| p-LpM`KPTpP e@P4o+, IPu@Kp>|rdA6 -LM@P`ppP PJ+@@T| -LM 3h0?? -JML2M 2R0,0 JNK@D@D Ÿ 0S00Q0SP @@2@0S 42@G`A BCDEFP  P`@P@BKT@0!@)@ @P 0rS BK@!1@/㔡@PI PrUE00BK81@0@0!PBNK@D@D(0KJK@@ 0Lb0哜PP" JnKBK̠p`FH 20Sa0 ޓ @T Ra0t PГ`Vᒛ ,0 S @(K||{}{CW|%CC-0M CR 0R0 SЍY00Ѝ 0-LMPH 0S S 9 @@00@0 20018\Q$ 0eP >0vpRC -LM ,R $P`P`20 @P`x0 @@0P` V U`0` 1Z0  0 @@00@0 @P0`@P@0` P` P`ZY P `VUP` R 0 0 @@0 0ZY  S Q R Q0T2 `0 \0P$0 2 (Kzuz -LMR`p``9 @@p S R  QPP   0  p-LM8P`00S@P`0 0 p -MLM100 ,0 0Sgip0@p@P0p `p ` P0XGWE0T0 c 0c#r"Raa  l,,!,h(0 0:0 05BKHH@  V ,DKRwP 00S z OX+4[,$[ SSa B RR02@0 ^\ ,0 S ,(KDO98E0D@ED M-LBMD DD8@B^KPEf@D 0, p,KPE  vP#0,KS02 #tPP t6l0S0`00 P60SH  4WpzD@P D(K 4R SB@,4[?S_,$[?R *R+4[S p RT  pD(KP$UR500 ӑgRT bR %Rc &RcRmRB tRI kRD 80Ep0<4 8D DD(0< 8 @sp$ED(0 S 0Pr`0O?   !5;BE 0(@KH p< 8 4BcD( D( D( 00p< 8 4EJ04E,t[BK@-W+W@00p: 3F< 8 D7< @@0@BK@X#P0@P04E,t[BK@-W+W@00p: 2!@< 8 BK@ 0"@@< 8 p,d[BK@-V+V@PP`0T QBK0A0A:@PG0"Sp0 040S =p00&Z Y  0y 0<$84p +Vpp-V pR@w00 x  @ YZ< @ 0׃D8 P`  04 ˃(  0ểp5A$ 0S @T S5!"@ p  pW R4d 0W$ ,0 S <(K@ED\DE6?Y@hD|pD -1L,M08 S< p 2 RkP 00C C  P/4 0 ȟ 04 00 @P00P@ @P40$!8 PP`vpw5vw8 ( @PU 0T. ŏ0w 7#0 `0h 0/o?o b 0c18@ !R `P, @PA @QT pP @T a 0tt0/S @@f~P8#(0|| dIDEI|I -L M20 pR,A,!(P( @P` ?P`0 2 @2 @ PXV& `@P 00 Ppq岌 pq``婌0 2  @00" 00 (KXII(JJDEEpJ -LLM2T P R1PF 50S 00C C`p$  `@P0@P @PHPL0T$PTp@PqUtuhhLQP@ 03WVVW \\XP DQ@ R XY  00 hP@5#0 `0d 0/o?o b 0c1T@PPP2H#H0NSnS TP2  \ < 0@80 0 0C C  |T (h"0@40 0@ 0 S0 S( 4 K  4pK4PpW@  W0X 00 TP0 @@0P`PU` p `P弉pT P0r0@@0P  ` 0@4 K ~@ PU``P9 @@0Y@PZ <10S0,4KPTP 82 <0 P@@` 0@ST 0@T04K`b0O&'"@ 0L H Q@ঞᆁDP \0 X@ H (K{EJDEEJ(KKTlKz|KK -LMCDE@FPG`@A B0ptP@ P`#` \0P 0S<<Kh^P$$ K(L|L<4DEL -LM)>@P 0rS@Pq0`0P` !0S`Ppa00C8S𯝙 yTwP LQ@D T@44忊T(10S  P젟p PP }P00@}P@@T |告@d T@TT凊T0S8 ( P/T<LLLDEDLM3PMpM -5LmM0e/ K,0 5i 0ll!h' P! @%,0 SHHDD(KoE8|P@P $u@` P@ PT`U" |P`@ P0 UT@ PTpUT0Sx Lh !P K`p,@ P088$0 `ppq pq,`p0@ P0#0 `ppqi pqdΉ0`p8@ P0ll#0 `ppqM pq岉8`p4@ P0#0 `ppq1 pq喉꼒484 7b@< @0pQ@PP@P`p `p0 LL"p0PpgpP` qh Ke/[uv\7< @@0pV  U 0S)0S& #R Q0S0S 7< @@0p 0 R0SR 0S0S`dTP@C 0C` F   ! \1SU 0SSPPQ N 0@@0@0  B 0P@`@1p p pLZ#Y!0!@`@w_K`0@0@ TḀp S P `PU`A `P  K X  !1 R! Ke/ ,0 S @(KdRQ(PExRRRRDzS$SHS, -7LvM0 ,0 ;l7 d7\7`9 @@0   Y 0ᘠ' 0@@0 X 0WSR  K 0SR V U6   ! Y 1A0@1 A P@vP@Ue/ KƟ0A K#A00 1 U0P1 Q u!00ḱXJ0ş SF`Vu0Ou?  4;0D@0@ 0$@0O0u?  4;D  ğt`0O?  4;DH 00@0 @ KCP` @  !$05xp!$0,xV UP`PU`@Zd 0x!  P BQ  ! 9 @@00@0 10S1 h ATd \ !P`R&1S"^K`AqT` /!1"P@` VUP`KP   K    R0SR  0 V U >K0@0S@1 A P`A0S 0Sq0ȁXY(Ko@Ἧ@Q0@&" RQ:;RQ0S01 S:!0b0?o0c1q0(@K00"0BBЁ00/SB0 K0Bv@ `!w1PqЁpq Ё \ K! +GKe/  ,0 S 4(K{zz|(|,|< -L*MMgNK:@D0@D e/,0 0: P P  P h`:` KAA !PP (M j(K0S*0%@@0@0 1(K0(KS )(K0@&@@9)P0CP UKU UK5gNKS:5 5@DS:@D d5 e/ Ke/K}< K49A 0A B:  *  G )RhPȟ0S z OIq0|:K0{:K 7K`P 2K0PuSUS OKNKe/@E e/A  o 8lhQC #XQ MQ AQ<  Q ?Q4DQRRQ UQZcQG aQ= bQ>eQ] X:gQ\qQ mQ` iQZ lQsnQ\ pQcuQ_ rQ sQxQ zQ wQm>, 8P Ke/v 00000C0} y v r  7P &0pV@0``@@T` p\ X %U0 %O _L 5HƟ0S  >U @@ 0 >3U 0* r+0`: u@P 0S|E x gp d2APP  0L@8  L+50S @40S40S gNK@D@DTe/gPP(D$P P0000ӑ yS P00 ӑnRPT400ӑyPgNK@D@D PPe/@G0S 30S ) i`@0p`p @TP0T@ P忁  0   0 T封U @@PPx 0Su D@P&l  0C\e]K e/޸P@{PNNK@De/ e/ e/K  `N^KPE OKe/e/ e/  |  %0S  0P FPH e/00q!00s03S0 OtHOK e/xP P NKAe/O }@ . , * { ,0 S (K{|}lSS6jSn|S/E8`@ED,TrdA||4T|E\TTTT|%T }TT6U$UTHU{`UUUUU V8V{XVLV`VpVPMЍ ) -X0LM0S@940P (0 0 0v94X}}h~8X -LM0 00Q 8P60P300S.00Qp P0 `DV U@0`0 0S@P00T0 0Q 8 n9 0 (K<4D}xX p-1L M0SZta0SV h100CSXHTQL1  D1\5\\1Q0000.1@$ KK @ t5P@#0T@0T0\ L` 0㛘Q_ 0f@TP 0厘Q T0T0 <00SP8@8Kp}<X X}}4Dm}XY -?MLM D 40\,0 `p40S9 SQP8QP3 0BQH#800 Q Rh30S\ř @30%Q+4#`\ ?KK(@DS@D?+VP6?KK(@DȢ؂@D(0KP P4P:0(K 0P4P0x"/?KK(@D@D?+,P0@" R?+Pދ"?KK(@D졟@D(KP P4Pʋ0!A8Ex1YPI P0( K0 HX l4P50H!0%@_ 0e 7  (K@@0?KK0(@D @D D4P0 7  L0 0WV$ ,0 S X(K<4P'20#40 Q 2 Q4 2   Q D K0l2P Q   0pq0S  2 2P1  1X $2 21 2dPX44,4?+RX1 R1 1T1 AR;;S1 1* X P?+d1 X1 4X@1@T  ?Da1@1@" !?;`00D@0a0p Vp ?lFʴ0 + X0 0?;0,0 X0 KDX }}}}H4]}]}]]]^<< ^}$^8^m @}P} p-LM MNK3@D0 @D 0 PC#35 P6|#3p30Sd30S X30SL30S @3@3838@PY  PT 30SP SN S" o3 i3g32NK0@D0CS^3bR@DX3V3T3R33PMP6,[R <[SYR SR sR yR Pe$,3(31#3NK@DQ@D33c3PP <1 1@@31  6<[S |Pp2 P\PHQ0S 0_00u0P0 0h0 0@@22 0 S Kp~l^^}0}}h~^}]]48^_(_L_X x_h.___` ,Ql``L````<<`4~a$a(aLa@laa0W -LpMPSp`@KPUPWX00S( a=0,ST!40 RTSa=08ST TS0 &$Q a=080QR@0h a=0,0QR404  RRQ KLX-0M CR 0R0 SЍd?00Ѝ -%MLM44 (K D, N(K@@$ P.0[/S l&~KpGpG0Z%lK/S/004D0(`F0`F;h*KP@5r0#13(K0: S 1'PYP%P30S &Pl]K(PE⒝K$PE(Ip(I`0*K4"@PL0S@30S# :K@5/Q ?*K@%P a1K @P@ 2 20P&PPOK A PH`"PT20S D2 0Pf,20S 2(2  2 0 S  v P54<S S 0CSwP%$"  :KPl!<51$)k@P  :K c7   00S 00S 00S  ,>0 +P@  /zI'$ ,0 S `(KXL~ aaaD~<~$~b~~}l 4~},~4bD~8W -LMS 000 @Y`%PHPV0,P#0 00RD0  %P Gb}`p0K@ <  P<#0S000  A(PY %P"0 SS SR P0 0"|0P0K #p"0S 0 P #m0S S(0@K2 !000D03/P0K R0S 10S 10S  O=p1  28 K0P 0S (10S 10S  -=0 U8KQP~PQPuP`PC V H004d ^P00S "(K\ D~}<~4b\~l 4~}D~ ~ -bML0 M x0R00  (P 'P P00<Pb K @ @ 0 S  K<~\ @W -LM 3S 0Y 0 SPVdPp`P &PP U@$P> P;W!0S: )/P p0S 3/P 0!0# @ 1S#Wh 0S X/pPEUH ᒭe,. }X Pb\ }xb -L M 00 P1E`p @4 @0P 40p3PDPT.MV K0S10S00S $0˅  I>K \00S00S +a8 0p ,0 S XE(K}X~Dj4pjj},j`~~j?` d hW -LtMpPK@ᅡP.D10SI 0R  0R 0R  60: SP Kb ݡPX't0  !ꔐc 0P t0`S P X 00 @ (K~k$k}8k80 MP 0C 0ЍЍ/ p-LKtM @`KPPHt000t 0: S Tr @P 0c@P@PiKpXkxk0M R00Ѝ/ -LMBP /00儢r"@Tfx"0Sp2pP` &`"0S 00CS00@Ӥ0L@t0Xy  S0`: V0`0H gLPc  1P@'!0S0  IP ``qHA0S 00CS00Ӥ0KP p %U(20S@ 0S0* 0S 04Ps  0mPxs00x  H0 ` < 30Pc x@E(~} Dkk@~ck} -#L M0PS 008Pb { p O22P ?s0S ;s"P40C S(XX0XXDDL0S H  O0 "]"0!S0@@L LHl 0 `: S'  S"  S  SGC S'  S=  S@h1  H10S8 01a-0 8 ˅(1  ( $ "0a-  000+Pr 0 0,f0 L   p0 L@p 0 P;00 D0 (K}x|l ~l0lLlhl|l  0-0LM0S h0P@0S0S 0S U,P e@T0 ~lE(t0M R00`00SX0  P00S D00S80Q ,0 Ѝ-Ѝ/8~}~|x p-LMPP` 0S/@Pt]p%@P0/S00D0< S0P `@@@@pll -0LM0 S0000000S 00000S| 0@00x00S lh0PX PD00S GPX~}d~T~ } m ~@-@MP*00S S R  PA0B0B0 Sa0B\7B0W BS0@S: P*0/S0 C7SЍ@-S0M@CC  R̕0̅ N 0 S0W0* 0L 0\00*0L00\*PЍG-M \*00S S Rpp* 2P0L0A@L S"'.pΏ"'.aLZ`P0  pPo0@pS  0Opp0@ S: 1!>p \*0/S0C7SЍC-Mp 0RP`C!CR00 Q0%2>&B P`L 0S W*` P0@ 0P!00*0@00P*Ѝ-S0!MP \P0307Ѝ p-x0L M0@SP %oP!`K 0/d0S &dKpD -0LXM0p 0 3a=0`0@0@TSVU@@a ªtPK 0@M\0PtK4@K 080 0R K000-S 00 00 00S  ph( 0P0P! P P00:U0S ll00:SLQ10 0 $(0b?Pp}lW}CEmm MP00Ѝ/@ MЍ/ -QLM0BS 0ZS 0hS 0Qpmn -QLM 0S 0S z0:pm4 -QLM 0S 0S Z0#omn -QLM$ 㡙Po$n,n -0PLM 0ShpPАРP(,`P=@P  P|኿@P0VPPS0    Up 0SrHn@ D \nn -LM bonE -LM axooE -LpM@P㔀K/pl@Ph`0@sP Xn0pSP  P0: S 0( Vp$K x  -LM $K`~G 00s@PIrF$0SC kR bR&mR wR!$+%$+*$&U*T'0@P$0 !$/UT0$0 @P$0xS S *S d1#pUT@P@PK -0L M@$0 (0 p$`K(PK .gp$姾$0 C0 Sp$0S K -?L M0O< @ 0P&?o启 p4 00@JS$/0/`/`/8/@/`/H/T/`/`/`/`/`/`/`/`/`/d/\.`/`/`/`/|..`/`/.`/.8-/`/`/`/`/`/`/`//`//`/`/`/`/`/`/`/D--`/--`/.`/-`/`/-`/-----.-.,.8.`/P.4 (^(NP  y040w !$? q=0_=(=  =4  -00-=  t=PUS >t-00h= D-00\.0DH=0A@ -0 00,=(= X p {i P&]< I00< 00< < \< < <<0 ,<|, 9<@h,,pK,= PR 0S 8 MP 0S;0 0-S0S0<0Sl;0S +; << 0BSQXm0BS@ 0a80 nxP@UH JdPFPUc +`@8ڷP0{ (hpPdl0 +0P8 |P0S0#3 %BPP Dl@᭷P:0 *X墷P pg@PPᘷP  R `00 )09P`8 XP8Q d9X949Q<* 8:P v PrppPUH M<\PIPU `P PWJPx gpP k(0KP@P(0S0#3 APP kX@ PX80L(("$P f@P P Pt `P 0`00UP`LXP[ 7P0 a00@JS\9 : : : : : : : : : : : : : : : : :t8 :88 :D9\9 : : :l9 : :x99 : : :99 : :999 : : : : : :5566 :,6 : :<6L6T6d6 :t666 :t7|777775 :h8pH@}P 5PP|  6P 6P 45PX5 P ,%5@P 5P 5\ 'P\@䔟؄|u`*a0BS!7L7L7L7 7L7L7L7L7L7L7L7(7L707<7`|00000 ` 00L$00F@ R[[PZ4Z 4Y 3Y X3`P P @ T 4X` p^c@ R T^@@ T<^h0#2kD3QP 3@3@00 ,WIl3W J0K1 DC0 3RV6 $1PV-+HU0 U00T0 "PT PSS0"R0R00p"Q00<@T"-#pB @l28!1 P   " R   2R  B P 1Q 0 _]q` `0 S5\U]0e0?o s00Sg00CS0 #`0  0[ Qh~P}h }}lW}qnd l~`~~8~}D~48 < d~\nX~ ~T~nrr(r4r@rLrXrrEl r4@E@rDxrr L~~~,~` r ~<~rrMT0}s s$~Hs}~~(~`sn9  0sWsE \ X sL~CT ,#400SH H0 L00S9@=@===X=@ P000@0< S#0<0Sw< @0 B< !0 @P000A0< S,1 (K -LMH@0S 8N 0R, 00 \@ s tE -0LM`p0 PA?R R *RJ[RG!QQG (10SE /QP @0QS50@0*S SP0 0S P*Q^' 0!S@@TR 0-S 0S ]S R^R ]R\ P0QS ~ p-LMP/Q`00C@ n R  0Tp0P0 P0A*00AQ@*00p t p-LM@P` 0P <000CS   0Ppp - LM@ P 0P/S0S/S媳P $a 0-T0LM@P 0 U(PZ [@T0L KK8 ` c8pV\ 0SX 0PSU KLL XI  KPp0@P *0S0R00S *K(R :K( 0}(K\ 0 -<[S K(Z>K0CK0C(Z-<[S K*KAA(/K ,0 S (r(KH  htttEtW -MLM30C`Pp.,0 0S  ῑ00C00St0S 0/S  <S   ᤑ<0C<0S KPr @ P.0S1 @P\k``1<0` p`( P0@@@@vvL P  -MLM20`P$0  R@\S@ S @0S 3`PP* p  P00 BNK@D ; 0Dẵ\R@ 0S @ R1᫵0 00PP GP gP pP00 00 Ᏽ0 00 P`0X S0PPPP $0 S ( KvvwPw|wH T W -t0LTMP0ddP d@KdK0 z Ff5 00S ww ~ 0-LMP$ K@P$0S  K0 -L MpQ3P;d#PP 0SS3@ @DT 0r/S *LcP<UT  ´ /003@PKRIPP80K@0 <@ I=PP80K@0 <@ I1PP80K@0 <@ I%PP80K@0 <@ I828"04S02 0 20@K m10,0 0(0 100 \P!WPRPMPHPP `  0` YP SPAcD!7410S (10SS  p 10S 00S pV000CSTTTT  00S 3p0 K#P,Q@~wxxH~$xP~DPl ~p \PPx~X px}xxx0~ p-2LM@`T 2P0!0S  Ro1@T 1P!0S  R]1\[ a@ 0S% S06S 0S 0S*0S?0S;:> 0S80S50S-10S(  0R# 0R!  0R S  0R 0R   0R 0R\pp ,=| 0t  -LM@p  Q.SW|p 0S0C ֜W` PPl 0##!>C=S0Hbp0H S]YYYY\YY YYXYX 0 <#d !>Cv.B B0 @#!>C0  0#"!>BDS0@k?B0  0!!!.A0r03 R0S )0B0@ 0#"!.B0r03R0S @ 0##!>CS0@ 0#!>C;S0*pq -LMpP 0Sd&/c`P00  S,UXB .UQ  /w PR00EU0@P!ZV 0SP00MR CR cR mR00000X$0` R$ 0S  P 000X% 0S" P  ᄲ#000  0R  0R 0p n\0P P0@@@@, xy8ydyyyyt x y 0-LM@PD 0SA Q0SP4 0#S \S0#S@ဋP@   # @ỉ|@p0Q0 R 0S  7P 00@ 00 \ 0| = zTz|z 0-LM@PD 0SA Q0S嬴P4 0#S \S0#S@ҍP@  . # @ᦋ|p0Q0 R 0S  P 00@ 00  0 =zzz -@Q@0@L@ M@!Qp(`K 0^0\(0 QT 0(K(0 00P:(0 ᙼ K -d LM0S PLp`0@T  0`(@PU K  - LM0pS+ 0崐P,0,`C0@ 0S 0"S2S0pXW 0,`FPU*W 0( 00 0(K  ~0@-0M0PS h0@ P $0S 0S0S0 0Ѝ0@,^Ѝ0   -d LM0S `Lp0PU p@TP` V ' -0LMpW 00S𩝙00S 0CS𩝙; 0`@T d0S0S 0R 0@S 00姰i餰 (  -LMH@P @08, 08\P  }{ -ML1 M1\0p,0 `^ 10S 0/S BKAAGP`p * d1dQ0Q 0hPHa=0QP 0PP;|!0d SP3`10S$1(QP B 1PP J "^K} 01P}~P P T00 SS00#<0 ^ ,0 S l (K~l~~~ 4t,}0}80}}t ~W -3LCM3p 0A( S(꜀Ā؀x30S $h3h T3X @3H ,38 a=0 7Qa- 1@a=0a͊b 0[  08P 0F5^9 1^ 2^.K0NS*1  *t|1 )p0C CXQa=0`b 0 @Q K^1    *0< <0/S 0 ) p0C  Pa=0`@ <0S@tb-0 @ X0   0/S  00C0(K( p~t~,0 -LMP3P -鬠嬀LMp P]P`WP  0hdd T000CSH 0p@PX l~ --LP0M0 |0  t00S h@0S \0_ P 00D0D 4G $婗 K0~}4~l Eh~< --LM(@ P  吗_K  -0- LP0M0 0  0P0S @0S |0_ p 00d0d TFH fUЮ8 $F K00~}4~l Eh~< v -H0LM @R +P  (M0 0  h. 0-LM;@PtpPP `\0P XN @00S 0 I00D|% @ D~PMЍPM P P   000Ѝ/M 0P Q0A000  B@ Ѝ/ M0@S 0S  O0 R 0 SЍ/ -LM 4FS댂E -l1LM0p  y 0D8 YlK0 0(0 0,00$(0480P@`p $,00< 0 Pt 4@`pCPPt e @ 1Q0^p0  L00@ @p4@T (K<:864;0Q ꀝxtlhd&;T!PhWHU0 $#$(,"(h Q Q  @0ShB <8#"hhtԄ0DTdtą4Pd$4DdDlxȈ -MLh3 M`3P $K ( H30S<  (I  \ K$@@ *㇮K$HjK2H$`F0`F"䢟ҫ*v"rǫ*k"彫*a200 x"0P寫*S0. WV("垫Ќ@Pˌ 0В 1 0IK$@D @D0!偫 KK$@$A@A*!K$JJ *10S= X1H1P0L@ Ӓ8p 0̒ @P0֓ 0ኒ 0K뺭 IK0$@D@D`0  P`4 *ح   Į0( 0R dI$KDE$@XlY@h.    l -LM@T00  00b 00P -;LM0 PK,0 @(plBT P  `VY 8;0  , 0010 0U :0  {9 p@Pg0SP 吀 0 R*0@Up6L@K0pxPKL0@  `B0  @<`0  4`K4  9@. 0 9P ^Y>YK0@잟쮟 6 @ A0@ f 8 < & 6 F f 5D0@3S0ȸttt4ttLttttt4ttttttttttttttܸtt@tthtԺtt\t ,8F0 @b#%=R 00; 0@00090:qPX0 4   YKA p0S 50S u BS@6  ( |60G=K0C0C N00@000  ' 0[R0@  0Q0 0 H0 & 0h6 0050 ! H60<2Slt@K(P %tK sK0 rKPNP,O50 0%W>K0C@ 0C @NP<50 $W>K0C@ 0C @NPn40 4 H0KwNPD^pTYK=KL0CL 0C@%E aNPL%5R=K0Ct0C$@UNP<0;CS0ʬ3cDP$0P?NP x4Qp##S0S@1 08n (i@30p .@Pp  qNK20@DK[K2NLNL /`3 00yL30@#ZNK@D0WK,3I @DL I0F 4 PU `"P0@ B0R00S*2 0 Spb@T PXR0S @80  Q@0(K5 20@MP<0K5 05 55 1^nK5 4,6p`F 5 E ؕ uP*G0S '& ,f`0 0S0S:K 00H | lW E?̋ .A'',  ,DX!p CČ،ԟğ (\Dԍ,8D hȎxl @Ex MЍ -LM0S1P`@v( 0S3T 00,᧢`T'%X% L0S `00S 0 T$0/S 0S : 0 S /S R -LM@ R000{!l -L M4 0  ) P`6 0CL 100R 00 `0001  L0 S  `0 X1  40H 0P[,1p(0@S4  ğ0001U V   q0p '@0 00C0S3   0000S Pq0 p 0004K101w(K t| M-L@M\pKP`@< 0q0$0K<0X0 0\0 (@ TP P` L0 H@  K  -EMLM$Y@, Pp  P X0Y 0003 RQU0T00`RQF.K B Bt$ < t P3 h4 044K\D XT ld 8t d `  C&?A, F0D_ 0,,`p7#  w tP B~KpGpG 0 qlR` &p8 PA(0S w `P| (0p (0(j6@_ B0Q00(0@SFPP8 F1A&实 0@S ޕ.X1&埞PՕP(00@S6  0卞 w10S IP 00jFKAAp4P!( 1@((P&00b06pPÏ 0 0C0 ,0 S 8 (K|E    p-LM4P0`@ᕢ0P7 P10 0L0S' `0$ 0 000C S 0 0 000000  00ppX p-LM8@Chx1PS  0C Ppph(  0S 0 R0 0 : S f௺x00S V \X@H00SD}Pp10f1ph( 04D \t -LEMt$ p4 l50FK< @,0 吡  08: S00l4 l$ 5R@Un 40S * 0S 7P  T  X0FK44 004K4`pAd4 `d \t X4TD<PDh=0SXP2 L4 07 ?P % P 0S 嵺0TU 10C13#0@S0 <l3 @@x~ T30: S> XTP 43  ß0"@_P`0"0 PdPR004K`t \ 2 d4 @FK@A0L"R<2 h200S XsB~KpGH2pG 0)p0BKH`GH @ P0G  0)0 0f)@PVQ# 03@PBp1 l4S00C08 hA   t|p$r @@101V00 00 Jt4sp| tp$;P00S s ,0 S x(K0  Ȑ Аܐ(4t|`h.$ađ -LAM<p`@P(  6AK @ @0W  V V0W 00 0S:0S:u@LP A.Khh0 Q B BTAK AA@ 0 S (刟Kp0ؑ -LM0 K -L MXb0&p0 4 (@P4$0S0 0S-00T*4P3PP#0So 0@t(0 TP0PPP0(0 0(06PQo0@ 0$@O$0SJ 0SG(0`YC40 P`  (0 PU` P$`0嵝P1 00Z40,V)U' P"Pf(Pឝ 0 ``0SOPR(P 0$@ L0@0T00000(K -LMQpsP4hB8Q t,0SV 0E0 @0 o 0 C|5!"@ 0$@$!0& P 0 0SO 0$@ 5(`"P Ӛ0 (0@  e`t7l0` P $0S 0S|E$ -0LM`00qP`00 0S0S 0 P0V:T 0Q 0 0S Q P| 0-LM@4廞(!PL00S' `0$ 1 000C S $,4<D 0 0 0000000S0 0 0 a0R08#80 0cP 0 4 0X0M 00Ѝ/d 0-LM@P0dP "T00 0AS X`ltt000SK0(|8 0-\0LM @?P '@000S0S0 P 3xP 0-LMP0@T 4|P T00T0S 4 0S0S: 00 p-LM0 0@R`PU p 4匙40Pp 0-l0LM0S0 XX 0 0CAP寐 T@D*@娐妐0000 -LM@P 00騭 -!LM0P`@0@U V!0S:0S* tpXJWGXQX(0@ < 8 0@ @J&8&1" 4 y&P0 (f0 0P0O0 0P0O < K 0& ?$&400 f|@|0 0 d0 8X0L R50 <0 (K謭hȭ0 -LM(6&8`!0@ 11 0L0X`.0(@PP0pp0X50 P0@|0|0  P0`SPT2(@Q𭝉P4ȭ -QLMp  P W0X 00!0S:0S* lh10 R QH1(6PoV;U8$a(0@P 0 ^%862 0R00 0(f00  0 W% ?K%0 0`(Vo 0 <%5!"@0 @D @0@(&0@?@1% 0 (K4d -0LM0pWP0`$`P@ # U*W"00S 彴 0x$" @#0WH00S @媴 04$" ࣴ鐭ؒ  -0LML@Ttd0X00S LD_P $ 4@d00d000< p$ -LM0p: SP` R@l  q P Rq h`P鬓 p-LM0 : SP`l0@@0P`Vup 0-PL M @'U  T T0U 00. 0S*:0S&:@ 7x00S Ed P0 K@ 0 @ Kx (K0ܓ <  -LMp`<1&0B?$ P4>PP 1 ? $0V 0 P0 00W0 0@0@0@ 0$@`p Y!(,0 (4ⶖl0l 0R \@d0 09P8$(00 Q xܥ$ -MLML 8`\`T, @ L( @( 2/ L8PP CL6`F#D 4h ` 0`p48 PA0 ZY< 0 0@ @ 0s#< LX2 R)<Q&*D(BK0NH NT 0S L"@0T0P得LT~P  D8HX:1D#D(>K<0C0C8 P8 K R 4L8Q L@1/L4 0j5 D(0;L80S00  ) L(P@00 0PPPL8e@w  Q PX0DP0 0  P Y8X:D(000 ,0 S 8n(K Dhd$ -LM0|#S 0, 00,0P3 $0: S S  S S&Q;PMK@D@D ~RBK&H0B?"  ,`Hp08 S*R0gSQ, @0 0d0!\NTP@(2&1C1/Ȳ0@@ R0  gp W`MK@D@DPPB>K&0C4 Pß\@@T `D   R   0w, ?80S00  # @00 0 PPw@ Q bj0 0PP$d Q $ 6 #1@`pX ,0 S ({(Khd, -LM`p@6TP  *0 R   T@0S|`P0S d` 00C0H ᆔ<00  ,00 0 Ĕ\|d -L@M\pKP< `e0$0Kh0X0 TP P` @D X8000 ,00000C0K\d| -0L M@ 1000S]1pp x1P` X0W0S P ` p QPUV:  X X  X 0 0 00pP(0`0 0P@4K44 0@ 0 /d6\400P 0 000<0H&00 P`(K|dX p-L@M P` K9 0S 0S  " KpД -0LM y-; QE -5LM0@,0 `_%儥儅u儕0P0@mS dS fS007 bS4pS( yS* nS-$ 0 0 0%00 >0S4  J0000 $000000$p0x4P0eS ,P L'8D0S 4 I  PU 30S 0S  p P30S  0S L0S F P 吰厰30S T30S t p偰0C0SXzU0SDtH0S0n0ShRe C 3   0 20S 0" 0 0bQ 屯T20S7 trP@ P 6`U|2 0 j0bQ X哯B0S D卯8副@T  B0S ~z@T 1 1Q 1 0S KAX1h"@ 0 001媉1姉1変0S' 00Sd`10S T P D&KP `" ($->K P `00SƯ0P9plW , DX xCL?ĕؕT@`Ė08hh$|tp x<̭ -LM@PP !0!0 S00)`倁pTZ  PpGT 1S1<0001118 !0!0 S00  00S =*P wP  @ R000  0R 0S R,0@0,0`FVp<Зhd@  (T -h堈LXM@pa  86$%00S# * 860  111,6\86P% "1'2!1'860P% "1'2!1'L0S d0 T 0 TT T RQS 121 111$6\T  121P@ 6T< pK080K6Vl0 6@@@' |@ x t WVW  V V0W 00m@ 0S$ 1S (< aPT d  PC 㸐%0 0 B50S @4K40 0@ qE0 0S hX0ST\P 00y %$0ƒ @_@ PQ P D0S  X0S Y0P 4L$0/I (4&0B?zP@P 80S 0 $+ Y Y Y# Q;P 00@@# Q pC6# 0` 0CS 1(0 0  Y) Q L0ST R H6@#k@P1(00 00Q "0Sm ٬j@T LPc tB0 0001S 9PPtt; l"00 Y c"A00  00   00 )&0 0 1 1pK h` dp T!6D 4 D 0 S, \A 0S @8UP D00X {0 0CP 0  o\0@`pl0x@( 0dS*TW0@hVf|x` tp | |@ 6Tx`K(K 4\| XȘt(X<@D -L@Mh@K<  0 0` 000K0pd0 *U  T T0U 00P | `@ \P 000S hKN @ PH0( 0fS:`p( 6X@P(KTD | -LMP`尀尐p"@P0S t 00 P0T @T R 0S P`FV Dhd0 404M`Ѝ/ -OML4M 4, 00AS;8 8M P# zF P B P&|ol; P Tğ 0]P <8) P,, 0:90BTdFNK@D3 @D@< @0K1I 5 (0B.K5 0 B44K夣3 B% h4 op(i RQ d#]F∐$@(0,@.60C/001 @0 00 ( 6"0S 儫V(0 Eo0 5!"@(0,@Ÿ0S Pl(\L0S % ֑9,K0B( M40 ΍0d4 `D FK A0\4 XD   X:1ܡؑNpP` H ( ,0 D 0ST> st: 0  P$`xb P, P 0  00C0aK P 0 0000C0@0 @$P0P %X: ,0 S |(K|`x(ԙ(ؙ|  tt8$aH< -)LM,0 S, 0 R0 0S-0.S*0@ST h)Z0` 0 P<  < @)L0Sh `0e 0Sb )B00 P<90<9 U(50L 41 R0.1K `000KK -1KO0.a[S @~P t< / 0@`TP%TMK<8(K @Ȍ 8(K` ,0@f0,07 00C0 ᯐ@w P<  < ,0Spp L0S4! .K `0-K0-1KHKK ,Q0 0 0PG0b(K0 ,00,07 00C0 q(K@@@T4 `V L~P+0@ 0$@l&L0SW `0T 0SQ `&`, P< < EV&0 S Ɵ 4 0 S ş '0@ 0$@0 $ş |%(KM?KD P<< ,00,0P4 85 00C0-0S(  R(0.S%,0S"R$-00 P< < < 0.S$00` P<90<9 <,0x$0,00S`p0S: QQP 0ğ 0DTtc@ 0 0ASp88,0Sß0|f @ ,0SQ 0S 0itS P@  0 : S0000 0 0 ) ,0S&ڒ~KpGpG@0 00RnK* @`FP `F 00 0">t20S Шh P@ p ,0S00@!L0SU `0R 42 0 0B S 0 0 000000Q, 0B S $,4<D 0 0 000000 00 P< < 0  00C00E@Q<900<  ,0 S 偎(Kdԙ,Q$aؚt8P|| ̛ěX$4D -LLMD1 0 BF`PQ>  0  !000S4 000S. p@00 000S 0Wpʊ` l 0@ 0$@X0  00C00 0 0 J 0Z*|xt -LMp`Ƞ,EP$ Q00S8 0S 00@00]T  R<0 08, 000C0`pGW T -L@Mh@K< 000Kxx1P`pd0 LXCWAH!`P \` 000AS3T"!"!"0" 1 0Q  A $0S 0S00 R FY x t   0\ 0P`p@@0S:0S*(K|t(T`4 -`LMp <sP @@(mT `V:hp -(6L{M F0,0 σ`̃P00VQ JK@      4(PQ86!  86&  ^860  860& &0&, K((0p !Kl!K0!K( P00P0S0P1 և !00AS 0%%%%%%p1  !PE  ?@d(0\:! 6R 0 <,9   01S20P2:1  ! P#0S 86 R0S1S 0H P p囥0# 0@86 0 S0S1S KP 860༠860P860q "00Ÿ0S &YP x!dP" 01&YP iKP &b000S &sYP ץ!ѥ 0!։1&\YP iKP &300K    ! 6 Y00S 1Q0 S  1P 0S0S KZP 1p@! 0 u001/ ,0 S P始(K|4x$ܜ$HP0M00 Ѝ/< 8 4  0MЍ/<  0MЍ/0  -LM(PX!먝 -RQLM@ *P~G!븝 -PLM P:!ȝ 0-LM/P.@P0 00+0/00$+彋+幋0H؝ p-LpM/`.@P KOP0: S 0PrS@ᾋ XKp p-LM`P@P00S 0 R /+ḝVp X00Sp ^D0D R 4($0$.4 8 < ܝ< Q --LM0 0 l. --LM0 0 K --LM0 0 K -LM@H-弈 hꨇ -41LRM pK  MOP@`K[8`?OP10: S 0R 000'ZK@,OPh1: Sp lᗣVPP S00S (@P U@ K0  x$4 --LM0 0 p-E-$!000 0 0000 0$ 0($0,(0@,00M000D@0HD0LH0L0000000%%Ѝ0@-ML0,&S  d0 P0 P@P P P Q\S0$60 Ѝ0 -LMp`w@P 0Ta0C0S0T00C SlW\ T00B Sa>@@B R R(1(!!  !؉ P 00C   HppWvo``Fe`$@G!_v3 0@ 6l FV`0@ f $T`3<̞ -PLM@ (00S oh} < -3LMsX3 ;R@Pc  f#l3R d pW T @TD 0@cഇ@J_ 0@Ɔ & 6FV壇L0$S ᬇr0(6(喇X? Ɨ0pb04\,0p2 0`B +d0S2X|0 000 0 00 000 ,0,00 00000 330 330 330 330 @0L@00 D0QD00 550 550 55 d00d00d0d 0 d  ` d0 10S d0\夡 "@`+UP 00S .p`@ 0R@  aAႡ T ` 00 $S  0H| -kMLM60@(0 6VK@A6` A`LP*. 6: S QP ul6P* P-@F0S4$,60SuP0`S &50S J%0@Ue5pp ppppp~ m~0S P|H5tEp Pd%(0<00PP/P<Op,kP @9E0S 40S4f.K0 BP PP@  D&P64#H 20HP@D0TD0T xğxtğt$pğp4p坠@4`@T40S H4HᏠ843ST# 4R0Sc &(0#@3P|HPP c3#mH(C3PP\3$ R xcB0S 30S2bC$N}P8Px`p 6 S  8Ɣ   !P V 3 P`P$6Ul2 00B10@}l2P`U (B}H2P< }(2P>|2P0@/!0pP086 2100 6Q1 1 |xA|0S`1 P<1LKꮟ  (0 S t$Kp,@` t|$HedApx\x4 @t?(|Xt,xܥPX@-h0M `0 B@ Q<0<8 0000PЍ萭 -LM(@㨲63(@ -LM$0 j0  h!꼏̭ -LHMRp S V0W00p  PU10000C0Sp  rX@< hK@p0 JP0h0 p0X 0@Kl Y0 X T 1d0 140 `` \p thKB$ 0X@K0d0 `@ \P X` Tp 4 dhK2 2l0 @` Ё D0R/0l 0D:``KVWH0 V W l ?00bl p0l  aಁ(K x@ | $a -L@M04 LK00 W K -LM: S  S  S  S S  S  S0P it -0@LM@0`@0P@0 @PPPp` {@{PP00T  R xxW P0H P@@ pW0 pЭԭlDd -1LM0`S &r@p@3 KT 10S10S10ST l10S h\q\QXT30S 00CS00@Ӥ0s<@FT 0 0S02 PP T 0S 00CS0N0 R0 PyTYT nTNT YTyT ȣԣD@EE -LM0@SFGGG80S \X00S LDRP0 00   0-H0LM0PS@  a-P0  4 -LMP@8 <0 Sɯtd< {0pS< P$1  D '00 40 04 @_0 PS  P ?  \ ta40 S04@_0P40|S04/X 0040 4 4 <00R8 (Ko%(K茭HP| -LM0@S` Q ?R0 Q0 P 0PP yl0Td`dp@6 S  8Ɩ   d@$6T頤$ -LMqP1ra10S 0S 10SeP 0A0PPPd1DPp` @vv`PU U1 Q f!00 Z0 0300S L$P @0PSl0PW00S 0P0@d0ἁ0 `&0p0mp$ ĤDdlԭЭ, -LMg  -L$M@0 ?4 00 t40{d0@ p< @,R@PP8 J ,@ 8 4 @_ 0PR P ?  \ 1`Z 004H D 4K@_0HKP弛 Z 0044@K0/X屛8PP8P <0@  Z< 8(KLT| p-h0LM6@S`Pp D088 000 0z `Ppԭ -0LM6 à@0 S @T@ 0 @Tx d 000X H000@ 0000 @ @DԭЭMЍ -1LpM0S1f `@0S!KFPD0  S;0xPP RP p@T`p`  op@ P P808b00 (KD@EED ح\H  -0LM0`SP AP 0Āp0@T oP0SP +P  :oPPl&d0 00v0S U  o0SD@Ex4 -0M CR 0R0 SЍ00Ѝ -c䓟LMP p W-#0S TZ#0S 3 0T0R0Sxx 0S \``#:0ST36#3 0PP T0Sl 0S$$CpP]  T"0SV 0S^^-pm 0SII@9|"0S@ 0 0S@MsM,pU 0S-g- pI @t# !0  0  0S^Q^p3 0ST?@|CT?@dp"0S@40pPp0S 00CS00@Ӥ0P@t:00S0#3 PP 0l0 0S0 0`00 <00ST06#3 0PP @<DE@EܭK\>P  0,01 R  $s0S 00S Q  R ("(04"400j $0 S $+w K P h2pl-0M CR 0R0 SЍb00Ѝ -LMQ X p`@ -0CU3@% R 0S,,%0SR00ӑR00Hӑ@ 4 R @0 S0SD6E -LM@RP 0S , T 1@0S<p `(<0C3@ R 0S,s ,0Sjx@ h R @0 S0S000S$>hO>hꀽDE p- !L|M1 K `@ \Kv0L0 @PKVdP1 K0x0L0  @TL0S h\@K` vT0 LP <  0 S $$vKp(i@x p-LLM`0d@KPH 0 Rvd v vH0 @\P 0  0R uKp(iH p-LLM`0d@KPH 0 %vd v vH0 @/P 0  0R uKp(iH̽ -LMp02@KP`  0 u @ pl  u0 L2Kp<  0R $uKTi ܽi  -L$M0( @K @ @@0 x\p  0F0:@KP`㔀  `u @ph  \rKpL8 ( 0R 4Ju$K  Ti ܽi  -0LM0&@K 0 uutt0 l@p [Q&0[S &0[@ S 8K 0 S uKTi  Ħ -L1LM04@Kg$ 0S  PH@P0U00S j@PK@nj8T W l忌 ,0 S Ts(K(iHi@̾DEܾ(8p -p@LMh tPP=L0L Ỿp01S(h#h邌T(i Կ p-1L$M0.@K `0 Ps0 @哾p'  s00SA[T04K 40SK xt001KL0h< kpT 0 S 8sKpTi ܽ / i  -LM(K@0 ( r(`\p  0岟 _0@0P0S  p奟h`P\0@Px`h@lP @`P,0@Pp@tP|` K@B  4P@XMЍPMЍX -LM` p 00 0  0 ` RS0P P@P(K p-LM@P`< 0ppqpO0 ?` ` -LM0 00 00@`< 0 ppq0 h0@ X@ @P0 D0@$<L0@0 0@(Kh| p-LM@P`< 0yppqp0  -LMPP0S 00100 tʞd` <@`p D@$<L@0 0@ -LMJ{KH@K$pGDpG J[Xo To 4P 0p o aP 塑"8QȈJKK$@D`D@DP 020S  P@80UZ ` (0 S Dn$K (i i DT[$E(P -6LyMF0 V,0 n0K0 Zo Kp8 n Lo @K`4 nP >o Ll@K   n 0o ڹ>@K  n "o ̹T@K n o 徹@K$ nt o x尹pwp3`v`3   2"RS XZ P900bW @[\ T K=Z[Q 4Q [nOK@D jnX;DPK ;P4 o?K  K>mOKB SniK T, n4 H]Pb[P aQ[ U@  @ `W@ @ \WhWW&qVZ 1SW^K,K0  0S P3 P+p\> AT1S0S0SQ!000C S0:S Q OP׆`T 0S,{,QV @TP 2S0S l40S DK "R,0S)  0  0 呆0 y0 偆lp7Tk22S\0S Xn0 啸P01S \10S  c00 10S  T00S  00S `p@c ,0 S m(KT(i i8i4iiii$0E<DPidB\ltpHi D$d -FML M 60 P,0 p5 5%5Q 5Q 5Q ݅50S  U 0S 0SS0e=X…T5  d@KH弅DeM'E8 l ,m  ַPW 堅4P,bP  0 幷P@内TK 0< T0R8 P0R% $40S  y30S((n 0<Ku30S))^30S  lSlBQt30Sp\`34ꈡ< $ @Q R Q R 4D0@0 W庅p 0- R40X,P0`V Up S_4Sx20SpBpR 4T0@$0$@SGNK@DP@D/dRKdQKk \l1 PRc4[SYoKd[ <PP<P ,@lc[1c[!Q``P?K@ P@OK@_Kd[K <]<P ,l0 Y/K⚄T $哄0@ ṶPQ冄 ° ,0 S Mk(K<(< HĶDEĴ8i8|ػ$0$ `TKiD<Lhi lx 0-0L(M0<@KP$ 0 [k k0S k0P00C S|<@K kP\՗T0 LSp< 0 S $jK0(ti$ 0-0L(M0<@KP$ 0 k ~k0S ok0P00C S<@K mkPl㓗d0 \pP 0S < 0 S $jK0( i$, -(2LM0pK@P4 0 jtH A ` jA0K0 -k1 ֵ@PCkBP 00S0xS  0K` P 0 S X0A7SD/A0[S0 K Ό@ KbP00@KP 0 j 咵Ph@K$ qj| j ဵP0x X0 vP` 0 S HjKT(i <Lli4i$i$( -@2LM0\pK@8 P`K$0 2j@ .j0tL0 H0 0L0 b kP1 L0 , H D < 4 T sP1PL0 00 C R0:S@H P`pK@`` 0` PE `0@@T0P0S$+0d0 KjP000S00S  dK|pdPU`K `0K` @d]T `0@` D0 \@K| (jp0 hѴp\ $0 S Dji K 0 ȝ((i8@ 0-0LM0Q $n 6PKkPP ! @0Sp=WP 0S 00StPU@$ 0CK0 4(`H.Pt 0-LMLP0@S0 s 40V n0P00@0  -4L#M0p(0 0S 0+S P`JOK`` <(9P D,yi84409 OK.i iiK  P L 01S I@K h072K8BKOKJ_K8[ <{9P L,;iT庁_K.h, /iK2  ҳP 01S #K嗁OK.h  iKl2 ᯳P 01S% l"82 Xu82 Hp82 8k82 (f82 a82@ \82 WZ R10ST OK.^h| hKH1 fP 01S: t墊70",2 8"42 / @@P##K0 UTPp K0 UTPZ 5 (0 S g$K  ("i %i Ii  ,8DPdT Qi th2 MЍд 0-p2LM0dB0 ~0S) 0+S 8m4 00R.h(K娀 "h!̲P 01S  g 1 10 A(0Kx1x!寲P 01S gd8 4g01@l(18 <8#"b10 @(0K0 偲P 01S `g帉| gP =00S  p= 0 S XfK0 (Td%i  "i #i DE -LM,@K 4Qg( 0p , ]`P,0 (0 $` p , (0S( ( 0p@PU 0S  xpP@(0UL00S@ s ,ZKxi ,T$DE  -LMm0 ,(g(0( ѱpX(Tzi p -1L4M0`$0 H@KPpL$ f gULK 0L R@ @0x-Sp@dFTP4@  P0PH K⍱p8 $0 S %f Ki$̧ p-L(M`0@@KP0 $ Rf fd0 \`pLD,,<) e 0R eKpi$9ܧ -|1LMtqP`VTPAyf0P00C SG0 (PgX@=  P] @4 P-0@ P01ű0 P0 00d0 P0t 00<0 `P0T0 0 L  (i zi i i H~i Ķi Ĵ -2LM08 SP pP fP 00S00C S 8p Xp0K~P d50P 04 <0 }W X < 0R00C SDSPn @ ^SPf000C Sb 00S .he  aR #da  \e  aR #Xa pe e 0@TP50 #040 ,Y RP%8 TR40S 0 R@ 0T 0"T0S$@$0S 04 0S 4 PU0BXZ@@, [(K\ ܾtдTd( `E -D1L(M0H`K@$0 $q$ d De p -0S* )0S& %0S 8PZP4 ` Яp4@`lPE`@TU4W` $0 S Xd Ki$ -PLM@l5  p@0P-S3 `@CS ` ASaS gS 4`4`@4@00SVpGWP dP  x dP  \אpGW0`00 <$<4@ QP 4pG`@ $@P3000  3 3 Y Wʸ30S tZ W x[ |dpdt#0Wx0|0 @\QP/pW` 3QWQPWg 2Q^[QP @Q2 R @ 0S   BR X0S; 4Q Z\R }QPP Q02Q P b 8/ 0pG1QP `Q N 0pG8/ 0030pG`ꌑWAŤ x10S 180S1W10S81Q,L(10S 00 c00100 mP 01S00S00S+ 00P c00 000PP8/\ X (< L T@T\4p<TP ęLpH |MЍ6L0MLЍP-H0H DD QMP SR ЍЍ0@-HH8@08 UMT S R @ @0RЍ0@Ѝ00@-HH @0 UMT S R ( (0RЍ0@Ѝ00@-HH,@0, UMT S R 4 40RЍ0@Ѝ0MLLЍPP-H0H DD QMP SR ЍЍ0@-HH8@08 UMT S R @ @0RЍ0@Ѝ00@-HH @0 UMT S R ( (0RЍ0@Ѝ00@-HH,@0, UMT S R 4 40RЍ0@Ѝ0 -LM\ $R R \ R \hi\ <0S@00S\ R $0̶ -d5LM0Q ,0 H D50S 850S,500S00  0 0 0 0 0 p        $ RR z_L %4 0SRxD0S  L0.SXT0S0 0 L~` V H`L@0 UT@ P  S R 0 0DP10 R Q tK0 S i d#@T T#08K^0DK 8#^8KD0K0 { aaBPP  X 0ŸS  a Q W@P  {a  va0Db : S SR  da 0-S 1T0` S 0V`0 ` @\  pW/ RQ 0@PS |@ P 8 `Y@K` PK`P ` `0L!`]^%aP`0 !x t pP `O^a0l  G^a0h 0S0d0  0 7^`d ` 0KX0 0S0  @S@T ,0 S P@`(K,4 ](4hDȶж\ -2LM0@S! pPk ^x10Sg10S*0 N000 K40CSHL0.S<0S @ TX PU<00S0 a +(K4DE -LM0KpcP8 b0QQ @P0@0 OO0@@0h~*g1 040  0S40!040  R0@4sZ4UZ0P<0S 410S(10S 1 0B? t !< -<0 ` $0 L40X00PU @ 0 S |宷@80T\ 0SP  <垷 Y aP(K Զ4DE p-LLM@0 0Rd ` 0 00000S@P0`P`dKRQRQt@p@dK8\PK0 @HP\KDIt 0 S ,[Kp ض@f< 0*;IK(@D @D0!S KK(@(A@A*KVK(JJ *DVt10> 10S: \1K4P0X@ :pD` 0: @P0; 0: 0sVU 0(HH00 @P]S *VJK(@D@DV VYtM ,0 S \kU(K$@lY@h.    E, -LM@T00  00U 00 -LM@ T3 00R . 0)S$0,S!,R @"P R x00S R d00   H;n P)00^\ -L8M 00@1 npPnn nPN`KPn .0{P\. 㜬T mPU 0 S (TK$L\p| 4 -LM @0a0mP4K8K0Kk0010S  7D00   ,0 S Q(KDhT|8ʚ;@@.A     | tE @(uЊDE@ -P5LM D5, 0 4%0S0S:9 Qğ 0d 00p ppAPtaPḄH0$H8#8 $#$40$t(" !S"(!00  |K⍐p(Tt  0PoP ` |`K`p` p KpK<pPK` P0K 0$Ll8@`pXK 0K@0L,`#D!$<ᔐ 吠 Tp0K@K 0D$P#L!,4`pK0K0 @#4!<$D"$P0@l0 @ K0K0 @#R 0L)0@005006OPm0 {08(E0 @$<R 0R| KAV p0S 40S \>| TK 0C  7 0C P L0  t48IP P v Pt40S 90  4t4PU R `Jtl5S5 MNK@D@D NF>K 0C  7 0CT KP ׺L t$0SPU $2d@K |Jtjlh7 P:80  4WInK`F@)p' 0D pP&)0( pPt8 0S\   H60 &=K0C)0C P6&0S000p70 x6>0>|4 |DP  EGKLG>K LP8&0CT Px$|4R G>K0C0CP&PPEGKLG>K L$&0CPx$|4R G>K0C0C|%P8608   A |4R`K60 @x5@D $G>K0C0C ^5 @0R4 \$G>K0C)0C Npr EG>K0CT0C ) * :p^ )+ -p|Q 4OK0@@ |M404  uM`CO>K0C: 0C P3d40  I>K)@& 0CD P!B0s CPy3  )000 00 0PZ30 V 04 ]@P4\2 r c K#\K0&KL  ) 0P!0s 0) P4S =K0C 0C!P`dPK$CP@I.K BP 0:GNK q@D@DP`)$ 0T `xP+o0)% `nP!o10p hHeH0|e10  dKwTeql0 8e@P] lW|E (?̋.A'' t ,X!p <C\|h 4T,8TpX'u(Lpx|  t@Ex 6Q.K  0r% 5 sx00@KKJK0NLN L 0 00y00 INKFK0@DLO~K1pG@DL000pG E $ <PU ^X!P0@ xA0R00S* 10S~a@T <PQ0S K@0  R@0(K4 2JK@@fPH0K5 04 |44 P2 4 5`4 $5 D 4 ENP0S mw P0  yd 2@ 0S0S: 00MЍ 0-LM4P4@4 :K  03E Q0| -LMӦh -CMLM50`,0 B~KpGE崅0pGPT4 X4 84 44 =rP dP jPx5P4 aP1 uP zP) tP*iP4 $0%P!i %XT  p(0 pO048 S w0T4 $ip84S4@44S CKAP lX$R8!pq@ 1 dR 0+S H@TPp 00F S.VWp `P`VS'W0P 0p ` KP N 0RR!>C 2#=S0DJ@ PU////t//0//./.@ Td0 T?#C0 2#0@0TT!>C 2"0r03 R0S 00C0@0TT!>C 2"0r03R0S @0TT!>C 2#S0 0RR!>C 2#;S0&1@PQ0U1pW010S  K@@pC X1CK@`E>K @PU`DT @d 0@-b=D 0M0APPQ=-C0D 0 L0@R Ѝ0 -0LM 0 QE -L0LM@0*00 QE,0, K`pk K,LW -LMD0D 0s0 404FP 0hu6  $W  -LMI p-LM@` K ` &pfk@ 0P0IT@pL Z?<0P0*DKpLW,\ -L`M0P@p@K0  j6P@00CS55 6 656` `V <00V <00V0s 0s (K -PLhM` ?66P 6vP;|6tFt ᦓP1`T6 L`嘓P#4(e` F *rH&62 F?%t5ş @0K5TK `kV hKLH@`0şfpr)p5@Pgl) 0D-p l <ş<4j ^) 5@ PlW) 0/-N)@PJ) 0pK3. 0,` p<)@P8) 0 !. 0, 0, P4. `p 0pK, (4 . 4. 0@P, 3- 0,@8P) 0,#@3Q - 0gP x3,. `3h ,~.Tpd Dg(03@`Pf( 0,x t ŸPHj| (2|@ Pl( 0,(@P( 0xK- 0U,` p(@|P( 0 - 0C, 0Q, 2- `p 0xKG, 1x- 1u- 0@P<, 1i- 02,@LPt( 0,t!@p1Q V- 0P1*0G 20k0  u>avs 0+- 0` +-\ \hXd  ͠`0Πx _(K  %W A0 $W 4Vn ?@{Gz?~@HMЍ -0LM . QE  -L Mp@rP= 0S<0S S5 |1 JP) 0B?S%oP ,K<P P`(K5P  (0SP,0V`U S0S P00 K -LM+ K K -LDM0pL[ 00 FZP0r@4@PP :4@PP֡ 00%fP 7@Pǡ0 EB#3 RH K⌣P T X x3 ll0o,PL 0  0S008T PL 0' r0 S@ 0<0 8@ 4 0S 00KX 80K0K<0 xPP0L`I@T 0`H0 D@ `0P"@0 X@ 0$"@P" TTP 20S P  0 dPv>iPj lPqjtP# rP sPiwP/ xPd@0S00Q0S 4x4 < CKL0 84S x4\ :x4 1000-x40x4;CKL0 84@S d4q֮x4`D 0CKL1 ڿ84S x4l 8x4@0x480DT44 ~$4@ PK P1 P' P( Pm@P;  Pg&P00b P@  P9  P$  PY/PE PS;PE PNH000Ix40x4;x4 Bx4@00S p0060Sx4 < x48x4004 00#<4p0x4 7x4 @$ L$ H$ D$ x47x4 <4L4 x47x4 <4H4 x46x4 <4D4 x46x4 <4@4 44S}nCKL1 884S GX2[CKL1 %84S \4x4p 0x40"0004 >CKL1 84S x4h 0CKL1 84S x4t 0CKL1 84S Tx4d 01 (!pf1 0bS BnK1`F@`FPP  MK@D @DP 00$0fP 0-S |ox 'lW\t,D\Ct\  -LM@pPg %`P 0S nS0oS` =0PP00 @WP @Q  0U0P P00 00 X 0000X  xoU 0 600 0K0 ?R0S@p&0"S8 0Yo@P(K舤 0Lh -L Mp`P@, P,K0KK  0lP,0S5$KMЍ -0LM _ QE -KML M6JK0HF H pP`  Ԥ Ф ̤ Ȥ Ĥ 弤 帤 ,0 b0@S񟗌POQOOODPOQQ$QQQQQQQPQOQQQ|Q sԔ qД o̔ m0 i %7 兽$R4  <q$R n4  0?x ?0[$RX4$p$0 @@H$4R  0@@;$R 0n 30@0  0$ $ C#Jpg3@0dS4$S@30SQ $00 RQ W $SR Ђ 0! pp: oK PP -nJNK@D@D0 @P:P``2 R P2R H"7< @@0@T S W ɊpW$RK, .pPOK cΜ,O=,.@.t$d T$XLA 0K @4S  1 Q  b $R .K =P Q Z  000V. 0, 0R @(KlWX|$(C d EFI PART0$px Th` -IMLM10JK@PJ+K⌑,0 J`p$ /KpM 0K j@0X P ) (pKP@0$SRğ00 ӑb0BS_____`___0`_|`_____ `` L WT$(K0c@PȟLD TCM(`K0bpKLt CD(K0s L $C;\4 S84 d$`4|(@K0`kPLT dC(d$`4n(pK0mL Cd$`4`(K0g @L$ DC d$`4R(`K0pttCL ,[-Z+ZltX X X$ 0$ H00Xp}`p@YP  X   0#@P x 0"@P`p+Z HDx@ 0"@P -Z HDk@ 0"@P`pP"\ ^@ 0CPU@ 07P 00PLDX4h @ 040S LTX4hl PlV(PH D $ ,0 HDS ,-=(KD$ 6`| -81LpM0@p,0 `PK┐KᘀK@V>Vd#P i0[?S%V =$P j0SL   P 0 S@@R hV @T TH VT ,0 S <(K$  -L@M Q, `PQPP ? 0 吐KpǏ 0PU dP |i0[S0  KK0 % R H 0U0S ,0 S <(K $   -t`LMdpP LGiHP@4@ Pp$ d3 p-PPLM8`@P @2S @p -0LM(p匀0O S#`@ 0PQ  =p00PP 000 -0LM(p唀0OS##` 0PQ>2P P )p00P0S o/P0 -LMA`B4@ 젟4 0 @U0S+ ?@P? 0("@P  0 !0 hT0 @R00 V0S 8T400 T$sU(Kp|  -鈡LpMP 0 3 pp  K;p 8k0: S ThQ ҆p^#(0 @Q0@7< @@40Q0, 00  |0 P`7H$0T 0S 0S 0S 0S 80 00$h$K @0rdA p-oLLMP`@ dKj7`0[00SDP0[00S?@0[00S:00[00S5@P0  $KM7$ 0R  0R >; t.@P  $K27$ D0R  80R #; Y.KpEFI PART 0-LMP@P0 ,7F.0 -LM`@PpP ,6 m0 +.sd -LMP`PS =DS K@,p@ BT -PLM@x 6U01U01`,4pK0po` 6V K -L\MxKP @p,8`K0p`fW@ <7P @`@P`0p@xK0S S@ 0  QRs000 0S\T^ $K0 M-LLM @0 `H6 `1!o$l@K = @ :6p@, Ό @0 @UTp(K -PLMpQ$RPR\ <:)0:,! = 0 $X L0(Q(KL M-L MP0Y ` ZZ Y)0SSp P 00 0,?0"100000 $0,?0"10 00 7XsQ(00)000S@40 0@ 400040 0@ 40 0 (KT Mp-LM 0(000?000 1<000)00) 00RR?0$00 1<0 0  0P`0@ 0@0 @ -Kp -LMQ`Hp8F .DDSD@U B L N @0P @@iP_W 8cP |p`W8`$K@MЍ/MЍ/ 0-LM IvPN8P  t0R hKp T @P H0H 0N᷋x* &vK0TTT|% -LM, ,K%  2 `R 1R@ @_0(pK \(0S $,`\8 1R  1R@Q0   (K0 8P(@Q (, O?1 R 0R030@4P ,0㖃#A 0O( 0R 0R0 @Pà P04 0@4PP0 ,0㖃"0S0S,,O Kd3d EFI PARTdD -LM@$$ 2 = PUd -LM4 4K{40SO/1 R1 R0 0@_ 0K0 諱p0`Q X0 4 螱@00Q(4 S 1O70 R 0R@`KSC 62 22 .2,㜞.p`@K蘜%^``K(Kd3|d EFI PARTd -0LTM0@`崀ptPK$0 P Z60S 0S 0S p#P d 1\ N@0S $0 S (5 Kd EFI PART -LM 0-x1LM0P!%0 Q2R  Q S}2 S R($$+P: OKN p 0 R  0ROZpW00S 7<@@ 0  KKP 0 S 85K0(<\d EFI PARTp`0 0-LMP@P @@0 R 00RJ0d EFI PART p-LM K0P @l 0S  N,0S#!N0RR dM\`  00HN <M 0M Kpx -L$M$K0 p.$`@VP  M&0sO 8@K}dPʐPV}P (K]W(0S ,Mj1嬀K– M0U `P ZPO 94T8Lq (@0<0P0@00D0p(0`p 0@P @Q 0pW@, P$`P` PU`8(P,`b@`4#P$L k 030 S HP K P$KdDd `t -LHMŸ 2RP 2Rb0K0 0pZ  0L,@ `>` \KN@ d@ @Q 30[Sc , d3L\pP✁< 00C } 00C pv 0\p0!0CDi1S 1  0!0C^,0㔓,!1R1S!  00M,0㔓#`d@P00pe0pp0@x0vWdd\K, UP(Kd EFI PARTD $<P`t -LMpP d@ ;X  K0C0C<% RlW'$)Ct0)hxT8) -LM@pPg V`P 0S nS0oS` =PP00 @ርP @Q  0U0P P00 00 X 0000X  QU 0 g00 0K0 ?R0S@pW0"S8 0Q@P(K舤 0Lh -L Mp`9P@, P,K0K|  0lP,0S $KMЍE 0-LM@PP 0S 0K< Xp(V U K0Xȝ -LMPp`!@0 0 00@ -ML3 M3@08 @8 <( ,   dPP @T|S x8t3Pd BNK@D@D` 0@#!<3@P U  U PP)ꂮKJ Jdp4 0GX2p `0S -S0 A=P  lA \$@P8(0p!1<20 @ B>KP0C"0C <<@<@T /i)6p@ P ;XF75V10 #NK@DQ@D0!~!ry>0S 8(R X7FL3F0S-0S 88KASA  #F F @P@(@KAA@(EP F 08#4 P@ 8 t ,0 S XT#(Kl+dhX)d'Th'`)d)M x)4)lP) -L0MP LKP P0AL0 H@ D0 @@ D0KL0 H@ LK⪫PE|lppD h$hhth-0/0K-Kl\> b\* N\ T\Gd\ f\ t\f n\ p\ v\ y\ #00#000#000/K .KX}8K 廝px⹸8 I8Kl1 4KN40(#S^ OP0SV :P 002`@  P =@T h/5XŸ0S pdO R<  0SLnS0oS0,"<0 00Ÿ00" <K守P 1 1 tP!~pJ1XP QJX1!X11LC@| mP "P =!pP`%0P 0PY  ` p@`p(P #P P N  0X* (K))xt+l+lWd'h')ȝ`')) 4 QE **C*l -0PLMp` o`P(K( r" @`p`3(@0v03T0S< K舤 p-LM0PS9 @P P P)00S S  P Px0`@ P\000s03@T 4000S0Spplt+0M00 Ѝ/ 0MЍ/ 0MЍ/ -LMP2먝 -RQLM@ hP!븝 -PLM Pȝ 0-LM/P@P0 00+0!/00$+!+!0l'؝ p-LpM/`@P KP0: S 0PrS@! aKp p-LM`P@P00S 0 R  ::3Vp X00Sp 8fD0D R 49(9$0$9Zܝ< Q --LM0 0 F --LM0 0 K --LM0 0 K -LM@" hꨇ -41LRM pK  'P@`K5:8`P10: S 0R 000'ZK@Ph1: Sp lq9VPP S00S (@}P U@ K x$4 --LM0 0 E -LM @XPp`L` 07/ P  0S000K -L@ML T L ƟX0 L0@P  @@ 8 ` |P{T XQ%;lQ dQ fQsQ uQ pQ 00S00A >.0 $ " P@ p`0` p0@P|Q@0`<0p80@40P00,0(0$0(K`1111 Ql,E -預堠LM`Ppp |0 0@R 00CS00Ӥ0c,] P0@`FVp1P1D 0-T0LM@T0@P0S 40, #(S@ 0hqh\11E1 MЍeh$1 -P00 P0LMS@ PP P@0?0 @@8 000 K@K 000K2-0M CR 0R0 SЍzy00Ѝ -h0LMP T00SD @00S4  By0 11DE2 -XXXLM`H"0S0 S0$@{@yvP U0S0S 0FS 0@_S0Sc 0S0_S] V__U0S 0SW0_ST_UP`F@p0W! 0' U00S 0S 0FS 0_S0S 0S0_S W 0 ;p U0S00S0S 0SEpxW p 00S `0H咲L < p`VrZ@pD1E10l10 0-1LM0@S0 00S 00S . |x*P 00S  nx00S0P t P0TP0@d0S 0Ux@DT  0 021DEx11 -LMH00S <00S 000S$ h h+x1x1DE p-0LM P0 U ` @}@P ,T44?k0@`p 0E, -0LM` ࠟ PpB V:`0 0pC@0 0 @R 00CS00@Ӥ0Y"[@ T t00@P 00p1DP1 -@4LMp444ğ 04P`0@ ^0 B 00CS00PӤ0!ZP300S0 U0S ß3P` 0@^ 00CS00PӤ0ZP<``P W::p0 0Cu "W00Dž000 0c0``00 U2@P u UP1"0S 0V't0S#h"P \2@T0H"` @2pG @ W`:p0 0C @0V 0`U00V0S`F U !0S ^00GL000`00UU`t10Vh10S(1  0@P 00CS00Ӥ0a*Z Ug PpGd b00VS00S 0000V 00 S d0R  00S t00S 00 00 00c000(Kp1D/P12111x1 11 0-0LM0@S 0 80 \  tP0S T  TP4 4H,( 0000`112X11E1 -1LMPK0`pȀ,0 *%\` \\ !\" 0S0 0@e 0S@e PD"Pp0!S%S0` \ K ,0 S $(K1211,2+ 0-PLM@0S\u0S 00CS00 Ӥ0p9Y r0DE$0M0SЍ[ЍuDE -5LAM0e圥圅u(0 {dPP(0 0S0 R 0 d@PL92T ]d$P BK@@ P5 P C.K BdPDl i 44$ K0S0^ 4$ K0DS0|T hD0Sp@ P d4  P6 PH$H000$0SP00(4!P 40S P #000 3BNK 3@D@D3,4 3 3 3 3 #P00 P P 2 BNK@D@DX PP3PS0D @cP 0 ,3P00S20S0 2 2R "2 2 2  "P00BNK@D@D P 2  RP 0Shy d2P  Y LB( (@BNK@D@D(f $2a P"20Y P T P 1 P!10@1 p 3 DceMaKPP#P30lt!#10#Pd!0\0 0!B? 00 0 (0 S ($$K1\1,,x1ht@,,,1,1f Q1hc,6+311,X11,1,,l10(11,6D1,h12-1-0- -151$111+ p-LMPPp 1 1 0AR0`PC00S 000@`00S000ح0S 0 W 0 0U!000S d0\ E h00S< [ (s 00C0p21d1`1-E11 -(-D p-1LM0`S 1! 10S`10SX1A0P0 |10S \! d!0 00410S (1 ! 00jV Q$10S1d !1P @b000S K 0'0000S 0P \ L00S 08 L` ~X 000p`1121X111D-EP-1p16`-1h-1  1 -LM`00S x00Sl  XsT0L D00S$$ ? `1DE12h. -L M(r((` 1S| 0V15 VY VsVpV+VlP10S10S _ r10SX !001@TP|Q0SL  hd!@000B@0 0@U U U@\a1 0@U U U0Sa4 KaP#[R 00CS000|0  B 3[Sh 00S `!V{(K212 1DE 11-2ht@1 -LM@K p P[ ꮸ0SIpK -cL MpP 4 0Y@\T p z 30S00S, U#H0 0CR  0(0N uR00 R0SR0 0CR  0820S0S00SM "0S I|0Sp n \qP"0S@c00q, 0S W q!0SLq0S " !0S0S0Ct 000pDP;Z <0S 0S $!PE0S   T00 T0\TS@ TT T@000 @000 TT-@K -K 00040gS,@P0@E04S(0 E g0AR8(K2111DE- -@DLMP p`@00@ S4$0P 1 -4LBM0ß,0 3P03@D O P00d0 0@蠛L0K@ 1@ KE`11.P1p1@D6 -(8LM@0Pp,0 @ @ @ @ Yp<!'7@07@P7p7'0?00CS000Ւ0P> 0S; 9p 000-S4+S80/S00|KP 0 &000 圐 嘠 00L S 0K$"0 @   \0K0@0 @ /pP`l00CS0h60S \60S 0S D60S 0S ,60S 0S 65 &0S500C05  Q00ˆ0 50SQ5@5T0 %d $NT  ND N KNP@T N  N N %000>50S  40S Q4ğ 0@P  00CS0U 0p0Np W p$P`0@{,40Sw 40S 3$F0S |K nP 30S00C0 0S K93@@d0#0@0 0KG 0S \#@00 @@0S 0@S |K 4P20S00C0 0S K0[ 0R20S0 0Sk `20S0S p"0s0S 20S 2,"0S@ 20S 10S 1!10Sw10S  jTA0S L1h!f0 '0S 18!ZPDУ 0  BS 0PU A000Prr 0@0 @0 @00000`<K B0C B0C$ :S S S:S0S QA"*0S0U0 0S /S ՁP,AKIK@A @`A d 岄PPT00S + :ޯP 0S` T00S D0P u 0 S (0 Kp/x33333P(, -PLMpQ 1`@@ f%S``03S .S5 %SW +S-2SiSK rS dS TcT U*d d000 @ U*  0 U*  0y@+ @)0@TT TY 0S Y 0Q  =  P@ T U*@p@ U*00S8@@e P P*3//66-0MЍ -LM@4P p9 -LMP` |@Pp 0eS P  0D8W +  P:88@ [pPt  00  eSP H #8 8 P, e9999:(:,: -LM08 p P@@@PP` @ _8 @[ 0 4K ^ p470S $ (K@:p:: p-LpMP@`PTp@͠ p@` `00 P徠Kp 0: S  7Kp4:t:: -LtM  KfP 0: STKQP@@ Pp`T 0SR k7~P@pl`7  ]p DdP Po@` 0`(K:&: -MLMⰐ`p , @a^KPEPE| /p d6(K 0Nx , 0R 9 (K:3 -PLM  ?G :ĭ(E; 0-LM@PPh'P @T ;P@P  ,6(* 00h<;L;\;d;x; -MLM30 ,0 Sp 0C`Pp8 8 )BnP% cP" VPeP mPqP pP sP xP V p  ꬨ P`"gepŸ 0@5P ㉟0FS1111W Y P tpl*Sp 8S}0u03Y0S $P(r INK@D@D" 0Gp  PP1:>6V_Y] W~KpGKpGA⠠KVK= `J0 p P)8H0S@ 8 H 8  (8HX $$!5Pp  p  P@`T V0@ J  (8 ,0 S T(K;lW;CE;x44p;;;<<3@-M@|0  " 0|0  "4\ 0 ^Ѝ-|M0,0C/1Q0#0C/00CS00 c0 0c|0x0\0nx0A0 0b0ЍM 01 R|00|0Ѝ/ 0-LM@K P 10 RK0 p-LAMPK`GOK   0RQKp- Mb 00"00#0\Ѝ -LM@K K0M0 !0 SЍ/0M 0SЍ/-M0 00\Ѝ@-0|v?M0|0 1?01 R  00b0QЍ A-0MP`  0S3 0 ##\0 ^+ @0!" |\|0|0@|0  " 0|0  "4\ 0 ^  pA܍M Ѝ -LMR^KM⨀KPEJNKPE@D@DpJoK jK K oK w`@@ TOK/Ka@``V/KL`@@ TOK/K6{x@t@p2TBNK@D@D/Kda@`\`XdVB.K B BMJ`F`B2V/K9630- j/K$K -LMJNKM`K@D@DJ_KjK  oK P@@TOK/K@@ TOK/K@PPU/KP@@ TOK/K|@@2TBNK@D@D/Kk@PPdUB.K B BZPP2U/KL  B$K -LM@K r0| 0C00CTK -LM K0 0 R0 0S K K 0-0L$M0P0 8@K0 0 c / \B8@K 00#00# Q0 0 S K043 -0LM`PK  0BS0K 0SK 0S| 1##0!\@!P?1!K#$1! "41 00 R5 T 1##0P@ ^+KKK0 #$ PKK0 0`0b/40Qsq$K8厏Kp@ KKmoK@34 -LAM K01 R 0 0SKy KM 01 RЍ/ -LAM K01 @R a KM 00 @R0 0S@ Ѝ/M 10 RЍ/M 0 SRЍ/M 1 BSRЍ/M ! 1LR3:|Ѝ/-M0 00\ "4\ 0 Ѝ@-@M  00b0n  #4\Ѝ -0LAMP@IK  0 S  1##\0 ^I?K@0 #$ \ KIK` p-LM@KP`Y Kp@-MP`pP@0000100 "#  010 " 00000#200 #  000 " 0#1000 200\x0@0P0x010P0x "# R |0100#R0|0340P0|0#20P00000 <- 0@0#1C0T\T00T0Ѝ0@-@MP0000 "  010 " 0#100 #  000 "  ""  020 " 0000 "#  010 " 0100\x0000x " 1 |0100#10|0#10000000 <. 00#2C02\20020Ѝ0@-M@ 0 010 0"!#1 010 0""#2 010 0"##3 01|\0| |0 01|0| |0"!#1 01}0| |0""#2 01~0Ѝ@-@M 000  |\#|0| 00|0Ѝ@-@M0 <0b0  |\#|0| 0b0|0Ѝ-M   00|Q"Ġ|0 00|0|  00|\"000ЍG-PpM`& !0\.@0 .Q@ TPЍG@ G-@MpP`&! 1B$0l\:  !0LJ$ ^: 01 @ 0 0:#P`@ЍG{0@-MP0@C0  # 0"00 "  \Ѝ0 -<8LM0 ,0 LK00 R-0[L [0;K @0AL K-0KA 01 R;KAA K00 R02 0-.K0S-K0 BL4  B5>KRKA=K 0C%K> L>)K A 0C> L> 0C> >A 0 > Y0L K 01 S20> -K B?K Bv.-K.H.H.1]K뀠PE%PE 5MK `.@D@D.p  sOKK  şSK0,"00|Q"$P1## 00 SK  0 0|P"-MK0@D]K@D`KPE0  PE0 \ !MK sK@D5K;}K@DApGApGmK`FK `FI 0Kyd 00 Qp`K_KSOK sKq moK e!MK@D@D} Ovs`@n@j TMK@D!-K@D B B5\Y@U@QT-K B BFC@?@; TMK@D!-K@D B B-*@&@"2TMK@D-K@D B B@ @ dT-K B B@``2V-K B B;mK`F`F@s/K  @ 10 R7 K@@ BP=K!00"0 0#P1 1@0 R ,0 S (KA 55 M-VML M02@0,0 0 X @i?WgK Pb 0 0 P 0 Q 0 @@P 0 PQ@K 0 iC_KMKcoK@D@D  1KLPK` HP ?  ?  ?0 0RP` 0@Q5 R 0@Q ,0 S %(K55 -LMpK@KK‐koKPW TQ닏K  B P      (K -LMp`ᬠKPOK  တ  KK    k_K -OKt ,  2  2 q2 l(K7 -}LMP`@    h 0-LM@P ,0hx -MLMŸ]K, K" (PE PE2 " `-!  &,OK˅:K6*K:K"d {K, ̅:K T*K:K K   D Kj 5 *K   '  k{  t:K  l    e`KK"-0[(KA A,)}p  = 0S G $ W * 9pW* ,0 S (K5 0-LM@jP(P0 U0 -LaMiOK`P⤀KIK  @8C$@ K -LM\p@:뀐@kK ዏKC  !l HOK 5_KoK @KV R Nk G C ? KOK: 3 P| *o # P #30cP   (Kp88 -LM )=P -LM`@KPp`(  q( 0R $Kp9MЍ -PLM4@ 00 ,  q Q$<EH<t< -LMpD t bGp  ޜP@ 㘓3@ēP`8 < 4 mP#=@P3  t뀛ᩛY h e* 4 DD#B(>8>@>= --LM00 W㔟 --LM0 0 P㇟ --LM00 z 0-LM@PZPP0  d -LMP@ `oP hpP ph $p00T0S<(@P 0i- :d p-@LM`P vPp  0R00 "l@0 S \:W 000 0]Pp 0(+W 0O p:B:X*L>B  -QML Mş@, tş(K @K\4 0T X$ `4 P `刚KK (A;K(0CAd4tp4 `$R00L4 HD 0 BKd@L@d l$p4 CpK,L0h4(K 0CI0CJ0S- 00+S-S00SX$000Q 84(K00S4 V4(K0 0S3VKTAp *K`$R) @P r 0R Kl30 ,4K00KX  K\\  KH  KH 2R,$K 3R 1R:KlpPKK@ l@@Kl 00:Kh$0PS0B  0S0 @    0@S0@ 0S0 0S0$0X( Kd Kt 00n0KKX L4pteK\^' K,Ap@PrU0@*00Kt0 l b0K00e\0  L4\p (K000K:KPd$~P 0S KHK`0,^00S 0s H ,0 S 0(KBX>>>(>= -LCM :KM 89K0 ,y,0 ((9(KP`@ &pP cP dP uP vP sPK@ `P  K@ UP&Vl(_Up`8@0dS K Y 0-S+S? b0P( 0K0 K7ǟ(K(A 0A 20/S 70S K&7GP P Z A]KJK(PE(@DPE@D P<70S PBMK(@D<@Dp7  DP`V  U 0&"RQ6 0O?   3 p\ 0p`P@: JK(@D46@D1(KP & 6(K@K(A*K A( B B0 P5( K0S0S K(@ @+5 (K $UxkJK(@D@D0X%Y,uH 4[--0pXP`G  K P $O  P D$000ABp‎ KPp'T@#JK(@D@D08$aY t( i/i/0pPpK(AA#000KQ JK(@Dt3@D0#7i/POP8jd#000>?C??@L?B@D @>(>8> x??B?x > |%B???@@@(@MЍ 0@-D1PR P @M P \ l0B^ ^@51:^1@3:4SD 8#8S@@@  <,4$ !4 $\$,,<0  0ASP 00b0Ѝ0xFI-0M000qS00l0 Q00 0S0 #l00S 0 00bR 00\ q00l\ЍxF PM Pt p5:Ph P (PT $P 0P< 8P4 0,(Ѝ/A ALA(AA p-@LM0 KP`  @%r 0S  i#VƠx 8 l, #44,< 0 8 , #444 ,<0!0000KpBxFII p-L0M K0 q @0TP`  d-#< @K$ K(0K0 ,P ( @ 8@ 4@ @@(pݘKpIB -LHM"000 0P# 0;0F,BxF -LM0@P pY `  0B0 S` a0B0SW`BA0B0S7`BR^ 8D4Pt`` †  PP2:0d0 -`1LM `R R p0"p(@_0$K Lq$\  0"0`PU U(@ $  0f #<4!4"<00P0p0 P A PT  Rp R 0 !0KBMЍ -0M CR 0R0 SЍ@Q00Ѝ -LM`QP@ p$0CV3@ 0P,<S Q0SP@  R@0 S0SP (00S>i>iPD -LMQ@B < 84!010S  PpP WP Pp0 CS   ^P` W Up t 0  CS @` VP<00S$ S Pm'BEDM p-LMHPH`@Dn 8 R0h $ L phE@BB p-/QLM`Z QW "Q Q;5QP 20AS4K7Q1H@ K0P o 1\%  0 K1 o@ PP 0  0 pYt0 h dd0 0 S L00S $ 000, 0S00KpFBCChF|IG -LM`@   Q (KoqOQ kO P  (KoaO 0\ p P 0 5p P0p @ % Q Qp QP Q Q0   Q Q 0S0S0S0C000  ^ P @U@00R z  T xB0P0o `t PW 0 d 8i Y  (c X W  \ 0 R s @0L  P   Q! Q! !5:Q! Q (Q! $Q 0Q! 8Q! !!|!|, x* tp! b8Z X 0@00@P oX@TP, (8<0 L L0  00S (Ko 0    00S (Kot (KoN(KIHC\CCCCGCCD$D8DA ALA(AALDdDEtDDDlFDD -X LM0R S S0RS  P0 T@ B p-42L$M (2R0`0 { Q 'Nu0A0S1  0 0CS8H,@Ky  P q k xx!pd \d!H =H W Q8 Q,O $L  7+  0D @  $00S 0@00@P W@TP8 <0 L L(0   0 S \KplF\C DDDE EE  E4EPEXET>dEEED@ -LM@pc&.laT cT gT D0S8 0 0000 T4(ß0 0c3 @  p 330 @0`0$ 0  r0`P p3tC0dS0C0PP L3P0S ,830 $30S0C0@@ 2P0S 20 20S0C0@@ 2P0S xP20 <200S0C0@@ r82P0S 410  20S0C0@@ [1P0S 10  10S0C0@@ D1P0S w<10  x10lS0C0@@ -$1P0S 88`1`0@fS@ ] 10S'Q >PYp@&.P 0S 0R 0RpMG|FxFFChFIIItGlFEFEEE@FEFFI FxItI8$0;0$7pezcyay_|]{[`RA  `R;  ZN`R4  S0<0 E`R+ 0 KJ @ ;`R! 6`R  ;P#000+`R %w#`R `R 4 "00 K@P 0 K T!0S:0!0` 0  0PP  <) `0S 0S 0 P  "0S0C000xt0@ T:`(KdFGtIG(II0F&@IlFxlFdII xIIItFII -PL Mp'H3cS@ nP TP dPtP vP qP22@ 220@@"IFp|2`ct2AcVh2PP 9(2@0`fSZ P 1 Y PF#r ד1pL T0y00  0-S] @PVȮ  ̮̮Ȯ0p `FVl1 00K(pL& 10SZ (1 0p  T 6T 0  &+"3pT T T T T `0 "뙍lWIIxIGtFlFpFIC2CP<@K  0B B U0P/SXQ ,X X1S X10ST    0&P00S2  2 i P   \ \1S \h kP\1p \L kP\1p L > " " W 0S  >02 0\/S/00LP 0S00@@P 0S 00:PP  }>R R u@0 0\:*  0@Sp "" V L` `At 6P02 \`KAp0@o?K,h<@T XXX,/d d1S X@ B 5\<0S(< :d 0h1  l1 uP h1S h!l1S l! ![0h1 @0㼛@P F |t!똫`l :R0Odp@X, lxP t1P0`t1 t!R 0S *0S ʟ0S#i#H>0`0S0S*ܐ(`P t l(!L:0S/ @:0S+D:R&Q$:0OTS 90S9#/9# >90S9 "9 >9坐tAT ]z:|90S Nh Px0[S ];P 0 :SSp`  :.@P00 eK8T01 01 7e_KUoK 0ᅨp@70X L@K 'P0Q 0s@T M h,= $0h0S 8 0 TQ,0SoK`1 = 00   04P ,ǟ0S ' Sw髊` `1s ` d`eP ˃0S  00L@K00@ 0P4PUTL`1S 0`W86 0S 6 wP`@!P@PUP㔕@Pv"P00  0@PUPP\AT' 50S 5\!v"R 4ğ $ 0 8S4ğ $ 0+Fğ$ 0# PD$ 2':P -}@P@ %P "0  $ #0X P #033#840S 4 G< 2S 4p@lP ]/KP K0B"t1 t!R 00 S S  6P PNK K> [p1SPKPP 2P |"0 S00`d;\`"0@K]/KP 0Bt1 t!R 00S S S R  hPP@h|PP0 b[p1!S V ` khPP2L @M|0:S4U|@P  #h1PP0S H1 u\S }U@Q xLQPPPpQQQQQ$RLRdR$Rr 3RR  RR,SS4Sx@SSSSSSSxSS3I8TTTXTd3lTPxTTT0xR@EEslRRs4xLyDTx$x\yTrT4UO`1s `X! P @00 S X d d1S X00S0 6d 0h1 l1 .P h1S hLl1S lFPB4Q0h1 @0Xa@P 0t1 (똑pǏl B8"|b0OPt d Sp@X$ylPP `P`UT"0S `0S l0S##:"0pÏ0S0S*刍t1Sl20S/ 20S+2R&Q$$30OTS @30S@3#T3#:t30St3 3 :3NtQ 03qr t1S0S0S 30S 4ut 40S h{P H:02 2 2 P d9P\ |`1s ` `ʀ`1@ŀ0@`1  \4, 0R (K -MLM70X ,0 004 \ `$  @P 70S V04t"l d%PL  0 S L$ @PH  0 S H$ C>KB.K0C B 0C BPD d4 h$ TD 04\$:P TEPC04\$YzP  YfP  SfP |6@ H`$@pPD  P Bf@PL$R  `$pPD TD %04PD TD Xp/:`@@P00T00S4 T2*P0#03V0S+ L40@0iP@@dPTT*H 9W 0S 04\$$904 P$ T$ T pP 0P4 T4 0[S];P P0#03V0S @T 0:S+0p0@T$ :"/P U P00S P:R V  R0305P1 : : ` pPT$ P$ PW 0S V @@V 0S /぀P@@@`@@30S @T3 0UD4 @t <$  0SD\y~}r -LM|0 @0S0S|@$x -0L,Mp0@ 0W0$ D0 $@KD K|PP`y00s?0[PS H  H0K廂PHn401 $0 S  Kr}VV4P -LBMBNK4@D0@D< +,0 $0$ -0KDD 8 4 p@4 `BKpP H`T!X$@P񟗰,4,D  0D 0oOt<$R  30S Co8#l3 TP1 d3 RR5V*U(4TV 0V04V0S,30S 0S U UR"2 Eo0S^5U 00D Sx2t 000C00WP2 0BSpRdppU00W0S 00D SW T)T0000p 0 "pQ045@404 5dW(TpU-T4$R4$1 4$ @4V`X@4xY P@?l!0SS5V4VX10SX04S l 4 1喇ZD4BK c R+# A_4Q 84@T S8D 8D1V0   p 0 TR 00S @0YY 9/0F ,0 S X(Knt}~,Vr\yVr}r9Dr,xn@P p-LBM"0 S 0  tjP \"P 4vT4P20SH2   8|`AK@0@"P20S10 1/AKAA 0P A rKqKKoK ^KbK aK.K]?K{ P p1S_t1S\x1SY A![1[[(,[ 1[[$Č<4 q 4"<,p 0rKqKKoK nKmKKkKjK iK$K(gK,fK0eK4K8cK<^K@bKDaK.K]?KH$P p<8jp1St1Sx1S  [[1[a[ [Q[[q[A[h1![圡[lXᬁ[[[\`q[1[H[L P![T d4@1 D|<, ă $x q  1,(p,40ǟ&<.  01*$t$%,.t0p:U@PwƟA 00CS KaK-K1P餫P <6`Qj^1[![R~[Q}1[S Dn@6 p Ƞ,Ƞ0 4,40ᤅ  Wş@ P v0S G\50S<PD00d05 5l  [?K|P PHpK`q ğ(\ğp a$ 8}ttPhbV 00갔0S [?K|P4ğ0S S l  [?K|P@ l ) [?Kx|P+xC|S b|P0_/K|1 ]|PV P#PU qG[\ \'܂0S" В0S000 G[Z_K\ H[hKHK <@@-P  h0KPP P0000S S E "0 q@@,,28  @P` p , 00儑40|10@00   @P` p$(< ! DzP0s`00 P0V`000Sl  [?K{Pr`@`0V0  0 d ! Bpp0S ,0 S (K}Xr r 0RS 0S Q00-S D? Th R $?Mh>0S H0S  PX> 08 S@ 0D H00S0L0 ((PN\0SNP00@0S @8<0S <2= = *(0@0 #0< SlPQ 00|SM LP>|t0S xt0 S  t@<= /Zu@P000T  T LT/00P<0SOt0 SPp<0S Bt0 S L<0S  0S HQ<0S , <;0S # @;pP P[H0S ;0 PQ   t Ph [4 40S=  R'_P4;00 :)00|S wD F&0 00S  d*0S00\:: o0 00S:X 80 :0S00 0(KʕP0S;0 @j0 S0JP0P0 P0: S d)0S00`9 o 90S p69h90S SX9 00 d90S00 0m($90dQ j80 S8 8^s0h(y0F@0S00 0H( p Z@`T<(0/S' 0S 70S0S5#,'X@K00/@0X0 T@ 0XKS#0S*L0S40 4(7 APPZ``u00p rpt70S3 60S 60S+6R&Q$60OTS 60S 7# 7#l,60S6 6 _,6~U W $%0@VF Z @T+>F  0 pPP@"0|p50S000#30#0iHp3P r00 P@T@0 pP~yr0S u +80S4 4  8003/ TP00P0 Q N0Sb#+~X0K 0OX0 T@ 0S $0S 0S 0XKS#0S*0@4 P@L0S 0S000#3 0GPP)0S0 0 +T t T 0S00+0@Sh夣䒟`p4p@@30S400@4GP  30S000@0GP qPPP0S BP BeKe20S. 20S 20S&XK0S0S *D20St2#`2#A+20S@2 ,2 4+2}10S400#3 4fGPP U t#!0@t10S000#3 0OGPP ^#K 80 S0 0 8003/@ < D0S D 4PlQ00P @0S9P@CLy4x@Q x$x8nxWrZZPy},4PV x,QxrrZ @E|%Da a\sZZZ[,l\yD[4x8nxnt}$x4d>}D 0 000T@X0RvH0Ss RQ00Sh 8 0Rd3p` \ q[ 30p l pK`0Kh0 d@ ?pM(1`K@Pȸ 0D3dAD0 S\1 d1 D B ? 10S1@  $Q41@P@@80S 00S 8003/40S 4k"0S0S{@ < (K -4LM0P,0 4pP` _OKt  `4|  U?Kx t pQ 巔p!LPK 廻P 嶻P$LK 0嬻P#LK P0tL0[S LK_/KU?KⓔP p : H)3 T1p`Q,,XT#L#L3TQHSK FT10S  KuP|?$tAt:$0dQS PP( 00S 040 bPP jP j0 [W?K\ ,ul00St ,0 S (KK 0C0C<$GaClWpWA\0@ @,K⊸@0,,<4("4!< 0S 0R@P0S0S* 4KppP`P0`0@0@p P`$K p-PLM@P8 PQ7 0R3X X0R/\ \0R+((P P% Q# P ,,P`@PP Q P d0dPS hh6P`@ Upp -\L MP` #p 00P  0I% 0@T K -L M0 ̠7% K -LM` 4K'4p00BP0@ T,Q a0"<4!4"\P 0K÷0pW00000  ෷4 R0 (00$ R:(K -LM@ $ @ K@ $KⲈ00P'$  0$K -LMP`@pp]C  Ki_" ᚼp]5 S"P* 0K" [Tp]  T0<"p]0 /" Ki艨qqqr8r -LM\, Kh?"0L. K`rL7 -LM@Ƞp`.0'.TP! .U.S Ut! 000t0 00000s03-T0S _T _TX0"0`@TZ0SD8Z嬵00PѭP,   p#Z嗵,@Q PE@TU0 P Z}, d0  PL 0 S 4PKptti$tttu@7(uDuf p-0LM0Sp0@Tp``0@pPp    層00XJLG@D4A(> ph:87|l\up d -LMp@dp P dr`vpTlPbPz8劭@P,^ᘬR8Ka- 080 0 3K_p jY0S fYڴP 3[ p WY0#S SYǴ| `P |&0S LA٪50S  Wp5Y婴 @0S 00K 00 #PU00`0 C@0 0@ Y倴 tH0s CTY(Kdu xpu@7|u(u47 uuL7u|;uL;uv -LM`*儶3\ Px3R pC@BXsP0P#0p P*J``$B0$#pP*,0P`Sp! "pP0*,@P``శ0 ?pP*@``"ֳpP*P`p(0S! h"ʳpP0*(@P``0 pPv*@``"屳pPm*P`p40Sj !女pP0`*4@Pc`f0 pPQ*@``l!匳pPP`0p0H:E1=Vd0 d0S 01 A 0!qpPpP`+*` V:0 P @`P/0 P @`P$0 P @`l DpP 5:P `(K@@7 v,v\vpvlv|vvivvvvwP; p-ML0M 0R0P0 `, JK@D@D*}P *㲵 P%*P  K@@*㢵 Ph%*`tJK@D@Dṵ 0 S ( KpL7 ww0`0@0E@TP 0[RA.0 @$0 00 002^_4!R.K8"[04"48#CPKhl0HRSp0``00 ,4S0B,8S 00 |0S0v@00 00 l1S 1[00 xA0h8K0@p"PU 44NPU 40R 80R 0S0V00 00?@T X0`S  *X0S  R 0l0S0  000  000 0,@0 00$ 0 (KH7y@7yl p-p1LM04@K0 rTnH1Ha0,PK@24P+ P  PX0S  ]= 00R 40R O= 0@ 00@TlT0 00X0X 0<,0 Z 0 S ,喰KpzH7@7$zP2#8L0 j&o880$ 0a&fa 5RM0 @KE `0 F@K ᰧq  xP  `00`01 >PAb X0P' X0XQ (1 0SwM 00 10S  0S  0%S @K &00P 0@T 0 ᾫᖞp|@ $0 S ` K|{x{@7D7H7y{{<7{47| |4|<|L7X|h|v(g -8LM88P P, l44H ㄈx`K IiP00 E cP dP LP=$qP3 uP8(`7 lP4 0 (000S000(0' 0zp 0: S 7+  yp 0: S 0S`` X'=pL7@ 0dS d㺠,wP @45S_ SpPL@K m`Kᜪ! ᘪ <`  P! ∪m [冦З@\0\Fp0\@LB  |0KpL4x||嬗张EPxȟJEP 5PP|%]=00l8hEP\p0P 000P 0 0 $㑗5p{L UJyPOt0S00$$pB0S ~kpp VL0SH RLƧxK_npHL弧T#70K@0@T-s*c@ԟ T00S+L埧0 ^pL咧 P 0S0S R2.p`@Lt Hra4H03P@Kb Hۖ@SXX0S RBpKFʠP t0Kt PRpK5h0\0 PRpK&0d p p}  z1pu I0pn o1pf>v0QpZ@P|4[0X R 00H0 `0  0, 0R 弨(K QL;lW87ltdh|L7|C@7|||i |}(07 }dP;<}PT H7L}\}ph}|}}}}}}}~X,~X~|~~~|%D~x~0Td xpu`l|xx 8g -LM☀pP,K` P  @Ph,0`0 000@0@,P,P  $KP;T -L Mp 4 储0K;PXP< 0P P0pP 0`@00P @T T40X  R 0SR@ ,PP ,PP P;U (Ki -LMP(@Kp[BP@$P@ T M;P% x:P0Pm(`g R@\  ^@8;T (G@ K $@h -CMLM4`BK0@P @,0 <4@P P0pPt0Tlp1@P p W@vBKHC.K0 BX \$ 0CX$T4 \4@ B0CDD HX$ \4 H D$AQ SQ` CQ BQcIQ/ LQGfQf XQlQ7 tQT4 +jSp X 8#@P<[0Tا@0 S T4 r H$ }CNK@DP  @ TT4 ]j zP rP p  eP @ [P X !@P P1pP ;T_ 0T_/P Z/P0 44KP/P K/P 4Kl\P9 =$[\00B1 8L$ L$ L4Q= L$0AS,P= L$0AS,P+ PP H4Q `.P$P@ BKAA âP4p ,0 S Xo(KxiЀ4X|4Hg -LMP(K`p EP@% AP` ʴ1P9 0P]-1P6 0PV(1PI 0CP; 0PK<GPL JP' FP0\0I A ,1@P$:($P; X0S5 2 $P./,+('P(  4! 㦦(w  d>< ;T v K  4L -LM`pm {P@  ;T oVPP3 ) 0s  }S MI L"`1R0 Q RPrP  =  o1 @4ናP 0R V 0   00X@T X0`SWXpt @ 000P0P 00S0P0 P0P000ldP;H7 p-4LAM0@P0 <@0C`&SH(d 8`<l(@3`$S[p 0 1RQp 0 1(RFp 0 1R<p 0 1G_K,p PP2 , G_K,ypz 2 , oG_K,fpg 1 , 1$1yQh1,P1481< 1]1B/ *'P@0` P@0`ݗ0`x0d0P  P ;V  0 S (<KpP; \`\g -LM@$`Kp 0PP $*P  {PP p ;U P 0s4 }S  K l p-LMl@P; \B@Pp P` 0s  S $6  phAh@ , p-LM@R` 4 0 @,$  <0, @ 0,4 @ 0,< @ K?,, @ 0]- @ 0, @1  |A 00 0   000   000   y00 00 0   000   w000   000   000   C00B 00 B@Pp  p phAdP;L@0M Ѝ/T;0 M  Ѝ/T; p-0L$M0` 0 LpPE't <@K P 㵣 H_p@,@ 0 S KpXi tg -X1L\M0p 0 TLp`(] @@K P უ -plE F 3[A0AS!`0x@K8  g p`00`0 XK 0@0@0 84 0 S 嘢Kpi 8i8g p-LM@P`0@P0`pT; p-,1L$M0` 0 Kp@ ( K蔄| -Lqa$MLK4K[0S 24 K Q P0@0P3/FPQ1Pt/2hh 80D X!L0 0K<0 KK B0 S0 3KiJpD0#S D0S D4[ 83[ 3[  3[ 10P@U 0S t00S .\0s .8D(K47T; x07 H7v -LM@Pp`pP8xd Xp@7k 4$ 0R K Ki P`i p-L MP$KiP 7Ll$@`00S  P0S2P0 0 @T$EKpl -3LQM0` ,0 |>pd 7p <KC \K? LK;`@ ^KlK5 1引 3 (K峐0Q @ ^1KP! ]KVK@T p k!|@K <K~ (K0 00|pKp x @ {Kp0 Q!@ PKLKc @"(K00000K @Kp@P0 3!@ PK\KE ؔ!(K00000K @Kp@P0  !@ PKlK' ẔP!(K0 0000K @Kp@P@KP (KN@0T!"00+"0T! p0@@K40"St T@ŕK0 -LM@0K2LT BTe ST lT` A  @ A @4KP00  p4PA<0@L$ @@80L#D< @@40D#L40 0@@#4<$D0 0L@#<4$L H@$4D@P`$<p<0Kj@P <@ 8P j(K 0-LMPL K@~P@ ,<4("4!<@K0Ԟ p-LM@`PB ]P. PU .P Upwp/P TopB :P 0 Sp_p( -L M@^0PP ;U$ !P:`*pKP PU G:P`UYP *K ڌ:V  b$ KH h -LM@P.`,KB pP PU .P`U,00 .V ,71$K`p p-LMP Kl0@P `;T ` ,`P4 @Pᴃ`Kp -LMx@`00S l0L0(0 ( 00(  Q000 KE  Q  >`Y >0S>5>9PK `0 nR pR lR 0`0`00`P \=  Q  `) =0SW== P =d=P `0 nR pR lR 0`0`00`P x<  Q  `<0S<<P,0 0SS0<0S <<0S` X<0S ` r ;000 `@P `p0 nR pR lR 0`0`00`P ;  Q  {`t;}PP#P`ೈ0S!S + 0S 0S@ Y`tGPn: D:<:e:0Sd B`] r 9000< 5`PPL 0!S +`F`0 nR pR lR 0`0`00`\ D9  Q  `#0S +h 开` }ؙ9`V `\9P GTPPgTiPVTP! 0 nR pR lR 0`0`00`\ 8  Q  ``(000^U\80S` `0 nR pR lR 0`0`00`P T7  Q  `D'0S 8870S`@y`0 nR pR lR 0`0`00`P 6  Q  Y`t&00cS0n `&0Sj TTof&`0S000 nR pR lR 0`0`00`P 5  Q  0#`>$60Sl 6@ 6P.`H0 nR pR lR 0`0`00`P 4  Q  h` \50S: L5H50Z00  54u0娔P< @JP8  t$00S800000 SP\u P00C00S40S x40S `00C00 SP 0$0S 0S j 8z0@< TH R7ڴC,s0 RP\00uu PKxq00C00Sd30S P30S} 7`z0P0C00 S  30S x20S !Pr Lz 0HPZBR0 J0 0P  W P00C00SCT20S J@20S9 `600C00S2-10S 410S$ !0!@ 0R`|`0 nR pR lR 0`0`00`P 0  Q  `1t L0000d`XaD1SH 000E0S](N0>@$> TPpdU0pdeh040 g000pPP 00C00S  0 0 @<4Q4 P+ >0S >0S `? P4 H?  B 0S\?0S p?0S `00C00 S 0S /0S ppW*? pWʨ60S`ڐ`0 nR pR lR 0`0`00`P ,6  Q  b`}PzxpqW QW`5 `50 r 5000E``PP\ |50S5 R|5 x5  d58PJ<0 nR pR lR 0`0`00`P 4  Q  `)0S0!S +y0S0S`4WT|d4 X40^P@40P0!SD4  440S (40SqW`30S`0 nR pR lR00P 3  Q  p``3 X3 P010C0S   B00CS:ʃK2 0f Q0 Q@L00\k Pe 0@Ɵ0C00@S $0S u0S " 0Q 0B 0S(ş`V0 V@L00'k P0 0l0C00@S P0S @<%0S  0 0Eş0 0cSK Q'0 Q@L00j P00C00m00C00@S l$0S XD0S  0Z 0L\2p( . (" 2KS20BS@0B  " 40O2 B 0/2S 2S*(P 0H"0q03"" D ?K傁P B@ 0`g 0Q/C QP\000j P]00C00S20Scc00C00PS 20S 20S :V0"HB0R0$B\|4Ÿ0S  0 o o(PP PUcL BP\!@0`00P@P Ut " JPPT1  B 0S=@10S <,10S3 0T0  B 0S 00S &00S  82 0<" 82 @B@@B |0 l0b@"R821: S800S800S .눶FFFFF<CHxhFF   0-LM(@(P(   E Q, p-LM 4PK*"* 0 ,@`Q(Kt c\0.PPP @8PV  倹PP 0S ʐP0<0V#c 0PP 崐P0V0XcPX 0oPP 0-SX0S $嗐PKp h| -QLM@ X=PPD P 4(y$0P hh F -QLM@ T=PL@xP 4(W$0P hF F 0-MLM0@AK0APA 0 op 0K T04B m=P |(ANK@D@D`PTP0P H 0 S $nmK0ħ ԧF -LM0D0S cP  D0ScP. Zp !HRB30S =30S3 x#@30S 00CS00@Ӥ0ꮬ@<&P;0007L6`+h P 3L( 5.:<746 ' F@x 00.S.0<0Kd8@8 @ g bg0@8 0 0 0[%W%000T P H(|5Pp@PP8S`5P @e<50SL8㼰p(TM]P4 4@0L(R 40TS4T 0LST 00 RàŎ0$0s$400s030 P CK.KI B BI`\( 0P(00 @0-S 0SL8SCC000S40C S;4,d30Sl 0S.1 P@  <KTP 1  j|/h!0P Y0?& 0P Q0 0G<$1P`P` 00@ < ` @P8 d0P0S0Sx@  jS00 c0 `X  `00@ (KP@T@ -LMPP`p< ,0S 00wSp rSQppV 00000000000rS9X0 0@9`00 0@ 00@ WQpQWH@L@P@T@ -L$M`QL Lϑ, p0rSwS ?R@@T Wڕ0040ZP~  0 `02X@0@0@4@8@@@@ @@@ 1ȑ0 PwS 0 !@0`P EWSH0090[` 0L wS 9XW@ W@@04a#̠#$#060Kt050K}040K/K0 -0KX60K3K1 K0K.@KH0 2KD  @ 4d 0< 0X  HKRdp  0P  P  0P ,0 S $fc(Kh@L@P@H@T@ -RLMH`p$H X 0P @@ R,B BQ RQ0Q@P`Fvd2TLDX@Da00 0 0 0 0 0 0 0  0  0  0  0  0 0 0 @^Plad@aV}VmFP0p0`F@@ VV1E0\\0\ 0 \ 0 \ 0 \ 0 \ 0 \ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0 @`FPV 0 0R@P`Fv  Da@@aP[ -LMPp 0a눀H`$H'a%XL\8@#8P@'XPfTPLD@DTLD@D(0U[E>^E0PEU\EPE@- M0S  00 0 0cRÌd@0  0"0Q1 P 0 0SЍ" "F -0LM0S  "F -LM`Qp@ 10S P(0^ ^0 01^ 4# # !^#$""1^"4##!^#$""1^"4##^#! ! !@D!$""1"#T T $0@T0 01 # "FM 0 "QЍ/ p-LM`P@@Tp -pLBM0`0 . 0K/K,1 |00R0@KK_K   Pf@0    pd`001((K 0@-@PM $^ 0 SΎ809P  L0  ( , 0 8 < lPPЍ0@-PM@ $P Q < ^ 018 0C0,0<8 0Ѝ p-RLMP@2 0@Q1S``,Pp (0 `S00`(0,00S0,0 (Pp UE20Pe$00E`S0,0$0p040$Pphp0%0M Ѝ -LM@P $Q ,0S 4Q 03/0$,0$0PM $P 00  00 Ѝ/0@-@MP \00^ ^l\P:Ѝ0 -LMpPJ $`VG 0S<0SA0S < 80 0,K08< 80080< #4 B80< <0 S0 h0 hh0  `h0S@ 0 0P 0@P0$KPM $P 0 S<0s3Ѝ/ -P00@Q0LMSS$PUP (\M ,0SJ 0$!0Wl0 $0 #4>\4p$`0% -LM$@p40`S $P0 (P47 (Q$ 02,(000( PcU4:b \ (0,00 0e0`U`1`!  \PU 4e [(0,00P00( 0S00, (00PR:0,0 -LMpP`P2 $@T/ 0S 0 S)0 S  ( %0PP00( 4Ub[(0,0e [,P0 0 -L4MPT  $PU 0S 0S0S0 S00H @ 0 0L0 8p<`D 0S񟗗tttttttt4@xT$PP 8t@ y@ !  ;@ 0S  0  Z  0RJv`V0']P0S'r0$ 0SH͟`F 30 `  0 0p8Z  0RJv`V'4<'<,4<0`80 00p 0S @ L  H00<`8p W 080T\ 0S  07s`0Z  0RJv`V 0 S 0 0T0 0+X0 00LP 0; 000!q`F<07s` Z } 0RJv`V@˟("('8,Rc`0@ 0p@0Sg HQ01 S@1 @!T`  LZ@0H L0d d dH L @0Z M 0RJv` V"'5t  0 0Q\0`d 'w`FR0 0h Z + 0RJv`Vʟ00 0'hq`Fh\0Q* h00h0S S.0L T0l T/p l0PZP@ 00@0h0T03L@ C 01QZ  0RJv`P Z  0RJv`V:7q 0`ah UP  Z  0RJv`V:^`a7q< 6 0n00'q`F(P   Z  0RJv`V:71a q`AZ  0RJv`V:71a  s`AP 0S \7 000 h0 0h P*d `0h ^P x:0S! S>/΅T 4 l@L0T l0p` 0P@ Kl0`P00X0X 4  p0d P0@ 0 h6 05T030CL01 P0 Z . 0QJv`S8  03 @C803<1 R0 Z  0RJv`7|`lS``@ 7p0  0@ L% 0H000HQ Z 0RJv`V:1H0C07q@ `a @ 00X030CP01 P0 Z 0QJv`< 03 @C<03<1 R0 Z 0RJv`7|`l@``7p'0H00D 0HQ Z 0RJv`V: 1H0C07qD `a D D,0HD 00`R00< jH Rr DD0 bSL @c 0 bR a(00b@40bRH@0 Q10l@0H0L0lH0 0 R0@0LS 0L L HQC @0L AH 0L 010S4  Z 3 0RJv`VD0Hl00@0@0Q00 L0 a8'4<,'<4 <S HD  00H`D p0 0@ L00H(08pS<`0S 0DP DP0@ 0900D pc`b0 00@ 0@0 0RV0 f ]8 QS@00<`T  \ 00R40 @P@  @ @(K@G-M⤀P00\ 0 S @0 2R02BQ0`\ @00S@T@ \0@ @@@'@\ 00S@T 0 sJ QR0Q0P0S< # 000 Q  0S4Q 0$A\0P P 3ß(0,  (,0 3ß(0,00S0!Tp!p1' PP#0 \00LS`$P08 8  8 800@0i^040@(,Ŏ0@`@0ià0%3l l 041 R @0@# R@0B000 02S0C8#(@  P P@@a800@0T"C$ \ YPi0 \00cSPR :  0<Q00SA 0P0 0pa 0bC1 0wY $ 0S0`4 @8914 @00Q  0A0000S@010pЍ耱@MЍ/MЍ/ 0`MЍ/<MЍMRQM Ѝ2Ѝ/MЍp -0LM x0Rp0 l00Sd0`0` \0Q0 PP800S 04 0(K Q, K<$KtpE -LM0@S &P K0M R 0呆K) 0-LM0@SP )P K0. R U0 pK0) -LDMd =)6@*ZPp@`Pp Tp Lp W0&oS0000&gS0000x&mS0000d&fS000gU) PU HU LUAXU fU RU:uUrUhU% oU1w0ES- pppT@ P@ 50S `V1@Y@0TS0F0L@ dP%شpP85d 0bST0SL00 LQ YW00LH H0 4APU< 嚢p 0<0 000C0S008K <1u@0SX< ;800S8 @ \ D 4@ o<K4K0 K▾P < ;0@0 000\ D 00 \3pW/ @000C0SO8KP tPPG"00D0S l 800S 0@ XP \0 D 43sP` @ \P + a20S P:F`Pp.yF@P @  p0D @0  `@ D @ D   -`P  p h ov40C S+||,|DP||P|ddT0S ㊶0SO 忬p 0S  嶬@LQh R;Z <0S00H0 0S \0PSXH0`r H0c 0S H0c0D @0P PQ \ RH04 X0c00  H0YP xzpሹ@P{0S PBu눶 Q$K,K(K KC,x@T( MЍ -0LM W QEh -0|bLHMPp@00 gP uP@0000 0S ("Op20iST`P0K"&`P  $P i0S UJ@$P C (K1H P l好@PU0 p劵PD/pKP0('X  hp ARzPPtP  'V Bz@ UT tp 剽P P  pWX@P 0SX@X 0㭭 DlWC l  x05  MЍp@- `0@SM8 ;0S8\5 00S0C;ౣ;0 000x00\%p0Rtpp@p@. D00\%<0R00p@@0\% 0Rtpp4"K<pD0S(P2 t40 0' 0P 0S #l0TU 00C0w 3#0@S0 㪗3 @@ |3~0: SP@ xt(P T3 ,ß0#@P0("0 P>@u3004K2H4 Xd Tt &'FK@@A'0dŸ07T2'0S lQwB~KpG\2pG 0Jp0BKH`GH @ P0G  0C0 0f3@PVQ# 0 @P ~k &t$0R0C0= A   |4sx| @00000&0 00 |$rx4s |x$j|x&000T00S ږ ,0 S |aQ(K0VU!0S::0S6:B@$e00\%0Rpee00S e00\%|0RteT00\%P0R0O(0 K 0 @ V) 0dK0ܓ4WK0C0CA`8 DH @ 8( D\5S0D00s030@H 00S&P`@00D#PI<@T 0`P`A"P "0\5S0D @ 0@0  88DH@0@88 DH @ 8 t0Q2">K `vp0C\h Xx 0Cp`4( T8 y4B80\œ\00 S 0 0 R \00O00<(PRPL1/P< 0C 0PPH@0S00ZY 03 PT@0L 00+ <T4,!P#P00\%0R0 0S @0 @0 0S @0@]d00 0  \X(4(p 4( `48HHS000 ,0 S DkJ(KK0 0C85 8E0BBK@DL?8E d cRnKd\ X ($@ < N8d H De 4E \ H@QT% H4HD\5HS8% L0/T /4#08040ß0\P4(00s03t0p  0S. @0TS>@0d 0t0ldd P/8#8C0\%00RTO0 @TO0@ Uc0 2P4E(0/p@0S ( "4 X4 hh08040 \5SmK00 BNK@D8@DVŸP ``E L 0\PL%X0 S 85 0  R APLX0O80 P 0t< S@0S00YX 0. @0` 000(`} PT00\%0R00S @0 @00S @0@b0 0 P|L%8E0P  @Pt0L% 8E  O'"`pX ,0 S ,H(KP;)T0 0!D00!BS 0:T0 0R B;000@<48`( 0  O6Po 0!$0S 3S 8 3PU\0`3o0 ? #1>U\0?0 0 A1 0@  0j0C V 0 V  V00000002@ @2P0\%2R ( pt20\%2R(00s03t0p  0S ip00@00820\%@2R p  20\%2Rt14K0\%1R00d0X010\%1R40040K 0$@10\%1R000D0d10\%l1R40040K(0,@810\%@1R000@010\%1R40 040K004@00\%0R00$0H000\%40R0O0 @0O0@00\%40R4h04O0@tt0 0@0 0F60p(KW4W0S(1 A] 00000000 幟p00@0dS {'P "`00S m0 @`0P}W$W0WlWVV UV,"DX CԻW -LM`4 pnP0  0l"`d"0@0@Q P 0,20SM j]4 }4 4 u00S  ?P4 a!0 0S1 0 @010M0x!`p1l0 @R Q @ 10S '] 4 : 9P P040 .c%`0 R0000  0S0S R0S0S p 00 @0@P `JZ4(K@KЗVWVdHK0  WV -LMp-0 O !S0`¯  ï^ 0Po xΟ1>0 20 P`ZY 0p>,0W4HTLd@A͟p 1>0 2 P0 `XWD pKB,>- 000Kp=H0 h=h͟d=  0|@mɯ QP0pO`|p.0 0 ` /l} 00̟\% R`` p 0x0OWV0 @ / l,0S< `L0S8 DlP| K0@S\0/ 00@1>  0S P` p0@00K0@ aP0 @ `K`p` p  Bp p 0@`  @0p0  N8AP @  ˟0 x t 0 e:ZY P ,K0\%0:0 pWFʟ R(0 BP!Xl <P0S 0 $ R(p4` -P   'P0S 00  " 4P   ,)0\5S ,= 009Ic000P^O@? O/ i0y\Ő@ \00T"S\45S:05S:  R8\ 0S 0 0S0s H0S Hh\\x0S \@P  h0\%40RO0 @O0@70\,hǟ`` \u W00 0B?QpP tG0SO S C Bt0R 1!(0p P`@ W00S0  0SP %0S 5W1(0/1pY ^ @@`@tN?P1!X0 PW00S0  0S $0S 4W1X0/1@TmP Pd 0@ |000S00S 6P X TPXDD<$00  RDDc0\5S 00   0S L0 G00  ) =00  8pß'603@P00pKX T `Kl404Oa#p`` \p \%Rh0O0STG 2Rh0@_@00lB  P9 0S YRP. b(r0\5S`0h0`0K0@ `)  006P@   @ Ÿ0\5S ,;0@x`K`px` tp xp WtPX10 @P!00`0/Rr Q pnYZj | ?SR@P@TP0` @0 020MT UJ  {`P1 W\HVPK(WWTVUU LTDUtULVV4UUWVp UHK@KDؿVK0C0C|5 85AL $%$5V~K 044K5pGL4 pG000`00 0S S$< 0.;;S= @0|0 040S <0|||% 0 <0d\|% 0 TD0S H*W 0?0?0 00S P0 \5 S0@0 @0@0@n,=)0K'A\5 S 0@l5 hE P0@d5 `E 0\5 S,0(0,0p0t@P( R01 0#\: R 0\5 S0X000@5 R0\4 XD GKA0T4 PD xh" XZ:@200xx"82 P0p00P`G 0SD 0ST> st: 0  P$`DP,  00C0l0-P 0000\!0C0@0 @$P0PxX:0 P00a0 @ 0S0S 0@0PU: ,0 S k<(K`x(ԙ ؙUW,_dKft"ghKp0S:  0S 0S @00s,T R\  0:0H 0@0 0@P`HX0(KVWV -LLMp@KD  91! 000K1pH0 j0!Pot [VSUQXP T` 00CS?|vtuutuuHv Q  A V40S 0S00, R# @ 0\5S00  00S     0|<0@P`d@t 00Xp40 ,0W 0 (Kt"wU|s(0 20 P`(Kd!R8Kh1SXK(PE*HKE00QD0E,hKQ1: P@nFD0*: 2K\l 0hKO XaKP,0 0 Po/0@ +4j0S 3S K \&0K\!O8<XQ\%"SKL`PlQ`P`KLV` U8K>C0 0HKA @,00CTka05KTpl$5S8?5p000$0(0, S0Q (0Q,0,00\5S 0 Rx0R0  x00Rx x00Qt0Q04 K! 6 0 S2$ FR`0K@6ARK!! `0 0(K(K1 0K1 ! 1!2(K1 0 0p8 0eS^000$5S-8K8<F4l  0@00 ^$0 ş0 R$0K<`0KP0018a\! BB.A.A BKS!0K80<PKo<KPQ (KT!R8KA R R3#!R "$2 P 00C   04 Q0 0C#0 0 004p80000000(P000C40 j0T| 0(P@@T00`@?!8<000(0, 40(08 40 ?D0400@0000 000R0 ʤ |`0B000@808@0D30Pp0,00 @@0 ?к0E ?ʺd,d00d0V`$@QPU `0P3  B  B00B!11000 0S Rڬ0 0 0(KT3\d -PLM@ (00S DJh}V< -5LM Rllp= d5duPoʠ 0 @PG0$\% 5RR1 <T04Poğ4ʠ 0 P+4 \5 S S ST  S 3S3S xğ @p?t0 P4*` ,P<ڴQ,\%4R  S0@Sh` V0 0B RR40AQR00QP30S0 @ O0PS¯0   0S3 0R[ 0RW 0RS 0RO 0RK 0RG, ,0RC0 00R?4 40R;8 80R7H H0R3L L0R/P P0R+T T0R'` `0R#d d0Rh h0Rt t0Rx x0R 0R 0R  0R 0R\%\5R" 10S I\!|1@h00p`P   \0P aAI@T,:(30\%R& 0O044D $0O84 Pxp x^_KAAP E^- XvH6: S 80@P>0S ]H+VP TH= R0&=P = 0Sd=  | =Hd=0S utt-0@l~hd=P` ` ` % %0 S P <M ?zP,(0<00` `P yxpP @b\0SL<@T,<-K B B0P d 8P X|,m00P \54 S0 `5S6 @Tlp4O,t5x05 ï @,% xp Pd5PWd5U l˟lh˟h+d˟d;d G=0;T @H;0S ;8 0G;00 T* ;R 0S 뀫*84<@00@ S20@ @P @ P 00S>@ P00L0PxH@ P o 00O H,H@0p 0 Po/H`0i4!0S 3S d1 0  p?âP4 `t!1>0@0 204L1 DR4@`0R1 4 >`0@  0#0p@P`L@ 0\0  L0O0080Q4 4@0$0LP0C0e0$0P\X<KD K < 8 80W<@V (KW 0X L000 0 0000 @  @A>A0B0W3! Q 000 80\@80PЍ"lp@-8MPP` P P 00S001 #@e0000 #%1?FA00 003 0 RЍpp@-8MPP` P P 00#e@0@0A#O 1"1?0FA1>0 !A Ѝpp@-8MPP` P P 00#e@0@0A#O 1Ì"1?0FA1>0 !A Ѝpp@-8MPP` P P! 00s3%@e00@@00A#O 1# "1?0  0@ #1>00 S20#AЍpMЍX -LM@"PM  P  P P  P  P  0 Ѝ/",0M 000, RЍ/W0 M Ѝ/W0 M Ѝ/" M0 :0Ѝ/" -LM@aP ][ P W$UhR 0-LM@o$0PP HPP@@9P݁P0 -\0LM@,0K, 0 @ K( K0 P K(KX -LM0@t P  h#ꈶ --40LM$K 0  >! K -`0L M00 0@0 K P @l! KX -t0LM (0K $0  (  K$ K0P (0@I! KX  -0LM0S P 1!X@0 @00P!KX8 -LM$  $K K0K p@  dKT 0-LM$ $0PS    $K K0p$@e 0 >K0| -LM@2SO"$ M0S00ЍЍ/" -p-LM@0`P 0 R3P020 0 0S CKp --LM0 0  K p-LMP`P  0MpKP@@p0S P@ PpsP@$0  @pp} -LM 0P`p, 0S) 0S& 0_P 00p@xt 0pdPP@ V0,0,0(`@,@(`@|}W -\1LM000,Q0p5@p 0`P0 ,@T"0 0R0 0Ap 0 0S 000BP /000l y"5PP4@000l,@TW  0-0LM@0S ,@TH0@SPP0HP@4P P40W --LM0 0 N K -LM@3p0hP K0 ?>P8$0w$0  }!KLx -LM@㷆0pP4K'pt P3p`lP Uh 04%K P 4`\4%0[ 1S000SU% 4@!pP0S 0S 0S 0\"0z2 0U"0sq|MX W WQPBiM 0S cbM0 ,K,0 ?0v0 ,B ` Kh2| p-LM`0Sp @Pp  Q$0P00 (0, S , , R(0(0phIp,0 p ph!W" -LMM0@000,@T p p`PLkp0S PE !p 0S0 S0 S @ T WdwWD 0-0LM0S "P>0 @0 PU0sh0   0啅 ,@T۸p Z@0S 0"W -LM@f_L p  pp t -`2L(M0  L2( 00 ,@  (K0K0pa0-S 61@0000j,@TL!㉚p/ 2p`+ P#<@K P 8` 4` u@l P !nK00`Fp 㴷p@ 2Ts0S H(8[SAi0S @T(80 Sxt.UK`0  $0 S @ K5d(L"x" -L(M0pP*4@K P 0p ,p 4P ] ]10aS1 D0 < @` 8p <DK;t |w$PK h\P! 0PJ2 'p@ T0S $ 0S' -iQ 00S0(0 (@Ku\ |p "4 H0ppp ,Q00 SKd"d5(D`"d -0-L(@KM0 0 60P@(0 S00 0 $@ =] 00 0SK0 -LHMpn`P  PP ldd\ m p@ sssTC  :6;PP  fY@ sY@ aQ@!Fyp10S   Pp 0 Pr0@  Pi( e `  0@K0 p (,0 $p`0P <@K;  8P 4P <` \ \40hE\}dW8P""hCl8HMЍA8M20 0 "P:Ѝ/ -LM@pPg =`P 0S nS0oS` = PP00 @oP @Q  0U0P P00 00 X 0000X  IU 0 N00 0K᰾0 ?R0S@p>0"S8 0qI@P(K舤 0Lh -L Mp` P@, P,K0Kc  0lP,0S$K -40LM0( S    tY QED --LM00 @P 80 ԥ եʥ xܿ Q p-\0LM0`SP@p8 (gPp>phYgdHX 0-LM@l hmgP\PP P 000@P 4,>$@0XedAYYl$4 0-LM D$K8 0K0$@ P ľP ±K0Yx -ML M>0@,0 09 I >  P > x> t> P\ ZD'K J@> `x* P4.4^ p J`Fl* hz -N0@&S; ,tttttttttttttttt$tl,ltttttttX= +0 `9S8=0x:  ( x M p RQ<@0@0  < 8 `ʖ)<R 1 `庖)d<R X  1 `娖)$<R 8 `嘖);R 1 `刖);R 1 `x)|;Rp o1 `h)D;R8 _c0 `X) ;R O0S *-F@P 000:P*:1 I-ʟ00)  p 9S9SL 5D 0s 0h  0SpP 0h l*&vp0S9P *0e) 0bS 80S NK@D @D5P9I9 I Ԣ(1 R0d: -W FpP& EP! ^KPE[NKPE@D@D(0(8Ppo(8po 70S* tPP%MKe/M0|: t: <1 =C1 =1 08(KKK J pZ P00C  K 0!@, ! !  1KR@ 7 R t* D'=K 0CVPt v  zK@ @ȩβpP#g  PkI P8PPP P) R9?9   P ``rpWZ50S FP 6P 5:0: | p z  0P|   KAA| #P   50S `:: S `:: S  ud 00Sd@ P@`Rp `0R00B SP| `4 Q,bpp*:00A Sa>@2 : 0 @@00@0d   0 Sd*p:   (0@Sdhh iyP |30 0 0ὕ 0@ 0 @@*0 @@0Y@P X 20Spd 0lPd2`0O?   4D;S##x`3^`V u2 <2 R P 00C  M R ʀ*(0 S;30 R 0S1  0#R ʘ101 S90!0St101010S ʌA0S x10st00!0S00S00#1ѣ10NK@D @Dt:  |**l00S   P *t400St | Ļ QY#YlW#YY##,YT###Y#"###d  Hr 8 4 @4@84 `R`0_P 8Kί ß 0S0C0 ?0@3C  00C0 000 ?>0@3C 000t30SvL3 Q`0P0 20D080U00@ d l0 0A8K(KYYU Y# -LM 0R  P'B -3L M04 S< 8 4l4 P2R@ d 3 0: 2P )B 00C 0\\0?0 <0(R0! @ d  2 0; 0@4D1 00C08P ,0OT<`S< K A0O00 ,@ <K 0N0 O PopDP @` DSǏ!. D0@W@ !@p`p0 K <K6x `?)` d 0 0@P0 0S 0<Kx ?04 0<Kx ?04,$000 (00$Kka#YYU Y8Y -LAMIK@P,`0 K0@ P A Q @ P F  A0 K  p  0 K4 0@ 0 @ E_K`pL =0@0O$+41 ! d ?804 0 KA#YY -LAM@PpK,`h(1A 0A SA  !9K00` 0  0K   0K 0R@  0K4-P L=FK0@0O4;0 dP04 0K DKYA#%#YY -:L4MP0OL0 H@ T `LȟP` 8d=R0 Y00 8 04 000cH0 400cL0 H00O85pY#|TTp, Yht@YY0Y E#YY#L\YY ȐY i@00S@0|  00 00 ,00|0$QPEP``0^3  Ba00 =B0  B110L 000@x0`Sj 0 0OH4LD ,L=2 000l1P_ P=LV>00h0 h0 S:h0L2 0<0X2 0\ d2 0 0R0PT0XT0P0P0HU 00 00@ 0PP40@ 0, 0a84 0 =(0 H4LD0 ?>0 ?0 ;0 4 D0840S4d@8t<~-4P`C  4/  5d U0O?`@P$+4P K ؤ\p %@p4P` 5P`8_ , 0%KsP5K0U@ P T 5 6,P P `F8P A0`@ @c0 0@` R pQ 0尐嬠 J)F#Z **0PgL70SY@P'1*0\%7R7\5*0G*0P78(@8Q0\580S\% 08PP K8pp P 1 ^P  K&WP [PP80X0 h R01:0[P & H  *b`p㐐K:\K`0S-T 0O ,00 /0Od )P0d PX cP@c@t 0 S P  $ G@P`pZ0 ?0 ;0 4 D0P  8K*0`PTH4LDVXKd 00 f0 R P000`P pV`0 00840  a0` 0/o?o b 0c1 p; 0, 08#80<0R  (K -LMz80@00, (0(0tm@KYYYlMЍs -0LM Ҡ\ QE -LM@K(e$P`㔀Kp> P 0R  0R 0R`V! ! @@P0/S /P@0.S0S .S0S `V@5fp 0S0 PP$K xZ -1L M1X0(0 p e'10SR 0: SN %PJ ߬0 SF7`K'. [<1 R0A@P層 0P<00S 00CS00@Ӥ0ބI@`P0S 00CS00Ӥ0ʄI PpYTyT (0 S 0 $KYEYdaD@E -LM0@P0 U`pT` p0  ; P@TPU T(K -1LM0@Q$0 _KPpPR@0: SJ0S l^eN` EpP< 3KCP8 ,3S  (3S $3S03: S p00$K͖p P2 S`!k3P QpD0`P [6P pT+H0   $0 S C  K X Z -LqpM`KP5P%0: S0Sd$0S P 0: S"t 0S NP 0S 0S ,+P@T(KYZYdZ  -D2LM0S 020S$20S kPPv g40C S085 5 5 5 5 t5 4 5 5 4 0!JPZ( 0S 0SO @ lsdA0SDH FP> f p8 0S0SH 4P, $0BS5 6 5 6 5 6 6 5 N" 0S R HYP 0S 0S \ +pX<`p j@P0S ,DofYYY ZZ -LMP`XT0P!Pp@0dP PP RPiP@ rP fP p0@0@] cp00Q@Qp0dSd00SAAPK0S 㧩P0W  00唫눶YZYYxCxYZMЍMЍ/ -40LM0( S    q) QE-0M CR 0R0 SЍ d00Ѝ -LM@RP 0S @  0 T U 0@S 10S<p `(<c0C3@ R 0S, ,c0Sxc@ h R @0 S0S000S$>h>hcꀽDE 0-LMP@0S(0hr BQP xk t d\00SP a <cc 0T  (0hO )4DE8L -LM  kRPm @Z` MЍ\RmMЍv -2LM`@P2 |R tphd2d"PPPfP tP  bp2 10bSP PP P 0@SX:P 嚜10S Ya@a0@ IpQp 4  PP `Da0@S 40K@P (0S 10S4 ),0S& 3KP 0K z 08 P000S A3080 <K]PD00S  dA 0X<< Q)lWrrpCt('(( MЍS -0LM Gѩ QE -LpM`p@/K@娢 r3X0 @vP0W ;PꢨKPP  P0: S 0 0X  (K x -LMp`㏏KKᔁ000 mP pP0  k PP P2L@@,!qap 1PUOp唛1 PR ؀P`p*f @P0/S 00S  ` P00T00S :P@(`PP눶lW(DCHx MЍ -LM`@VpPq \V Vf b[RC[VS  0 ^S0 0]S0 $0[S0.P =P:P 0SE  0]S0\\S0nS  0S ]S00]S*@P"? \R0[S  S nSP \SW0R0000P R @x0 -LM`Rp00@P0@ s0@0S S ;S s0@0S S\  40gPV@'  @U0(p70D妤 03-040S04  004 0 r 00000  040S04  004 0 r @00000S 0 \$ 040S04  004 0 r 0000X\$ 0S<`  0b0 S01@0S 0 P P @T0 @0$A0$004 0\SSx 0P0 L00@04  P@$ R@L n 00  `<4 D4 H4 <$ 0hS * h 0`S< 01:DD D4 P>H$\SQ$ RH `@T`FH - X*P \  0 S0@B 0TM0S@\T&T\00@SiDd`Ld  S300`0S`P0i#L$00$ P8$ CK ` 0pH84S 084 8 r 800084 gR 9R1R*Rs R;RhnpR wRcV `]p[V t8 㮢0@s@L`@0S84 084 8 rXD000 S dT:84  84 840SX$0T0X (0SX"p s0X$84(84084 nS04  004 0 r 0000$0;Sh004@0D 0\SSa` @P`SmD PP80  P0s 0@T .I u000 S 7d,Z(ZH8Zhx$)<pd XU d,8T4Z0Z,T r EpPUph\D@ -0LM0S002 wPP 00S00S  00CS0y 00>p800Sp30Ddd -L|MHE0S 4500S$50S %5 5X%5 4 td$P! $0S00CS04yt4 00G>p PD届0Kl4P0S $44P00 P# w0S SP m-0S P 3P ]@@S@#00#0S`30 0  H3P 430Sv KP @0S i 00: S ß 2wB00S +  + P0  c0" P0 :t UhpP@庠. 0,G4`UP ;!0S0 U H!0S0 U!1 l1t1X!0L10圜1P@{T  P1 00#30EvPP 0@b0S ] 00 R 00S S B0 00  wP00 000  x 000(Kdh\dTxd@EdHd8\p\p`DtE|% d@l\ -LM@ 000@* 0-LMP @ 0P@000* -LM0SrP`00S: :SfP 000S S+P 0@ӟG 0l`0 00T2 0DD"P88  "0 00000KH@P# q000 00S:0 z0 A00  RN0#SK0nSt1 F000š@,0S 0#S0nS$1  000 00S &00+;0 a0@\ \0 0 0^0a l 0000P000 0 00000C(K*`\d\\\d@d<\LT\d -"R園圢L0M`p@80 07fP aP eP EP) nP iP#rP uP "@@@8@ 0!S00 1@  0o(ia!Wp1a0@@QqP 1 @@w0SP4 KGP3[S0(!0SP000QEp% ?08 0 Q P0S{PPt0L˙P ` T0償dlWddddEE`Cdht@4pd|l\ --LM@0hh0 T TP0H H0H0͑ (Y WT NKEdd -LM@P;   -LMⷚ@P*   -LM$@P   -LML@p`8 0)P 0)pd<0M 0S0000{S  RЍ/d -LMP`p/0wS {S& sS'0 p P 0@ʝ> 0pW0 pp P @帝, 0(EpPU -LMP` PpKQ@W000 \ 0 0 -LM`0Pp00S0@ 0V l0 l00 T000P S (0A,  Ki Kdee -MLMp1jKp0(`F````FP,0 "0 0R R0L>@P 0@*0sPQp P0W00S00#3 rPP 0@0S j 0X00, 0R$0 40  ,E(Kddd@Dddh -T/L莟TMDK0t 0H00-.00Q0Sc PK 0 R0 0+ RN 0SPPE 0 n00 > R0 0 R0~ 0SPP& 0Q͟ 0S%!%*000 R0 0 R  0S0 p3P 0=0C>S񟗲       r   \s s      u  Dv                 4r ~ r s   Ls s s   s  lu  v v Hw w }   ~ 4   ~ [k0S:K 000P 0 +0 00  0@ @C00000S H0SPG + 30SC R P0080` c ; K 00 0  0 j - 0PL`p@@ʟ0U0 P@Vt  000 \T <*TP# T :$TJPTɟ\T@V P )0iTP9 \ێP`0VSI$T T(90S00#3 Hi(qPP 8@E0Sk h90S0S x0 X 0S vTP\ 00x 0vP~M0Sz`ȟ05 0SD'o0Sl  P H`0  @  0S g 8T@Rw0  0SI  *TE70S G0S lW0  0S  T͛Vf0S:F 000P 0 &0 00  0@ @PP tƟp ^d T60S  0S0X00$ #@d 0P] %@0l@ 0@h0 h0Selp0 SRl l 0T l0SR0S 0S h@TyP(KMЍe0M0Ѝ/ 0-LMPP0@@0 T 0S 80J0 S   R000h7t 0-LM@P@-T@0 0- pLM@P@IA@P$I 0R0 @@0 -LMPP@ph qDIE`Pf@PIV@@U@ -RQ3LMP@`p:Q P*I h -p`LM@P lP mP ?PP%p ip01@PP0 X'P &P` 0N'PP`0=S -TRL ML"@i?P 01p@W {I`PV 0S s0S hI100TP*I0S0P 0 1S0S@T 1qT\PA ppiPPP? P  0+0#0K"K!pKU?0#K"0KR 000@ ;0 , 0k0Q ݊p#K ؊h0@0S  0PU} t3K*d@< 0-LMPP0$0$@QEgPP0< -LM`P2 0-S/ @00B Sr( d3000" PP P ,DP plP sP ?Pp ȀPPHPȢp "hp @ W U 0SWxxsHR[ S Xr@,PKkPD , 0BS B, ,0"0CS0S LH@0S`n1 R Aa[$ R @ 7HT2H$1Q40 0@ 40`@4@ B~P b00P0 ] PV`U0H 0!40K4g`3\ppP,K`&0%SNP  )kPH,p` x>P  tG`P@T`$K |B0 lB0 \B0LBQ <B8B%V# 0 10 V B0S00B V BB0*` B`Y`0*0 PUl0.@~ (KtpԜ x $,DPh.MЍ -L(M0`0eS U0pKd4p0S Px Pps pnS eS ESf 0Sp R\ 0-SY0SV pP eP ?P RP/ nP, sP uP rP%0 @P0>B@P  HAP0 *B ibp@0 PP @P0000C030q2 0 80 4 80P0@0 < a@0  cR@Kf`P\V00 S =  fR) aR 0R \R1 R@\ - *bR cR&rRH $ nRtRL  vRP     @D  00C0S! P\00 @ 0D0 0H0 0L0 0P0 0`V0S 00@T 00 @ 0000<:<40-0<@0S Sx``K@=p,` 0  <0 0RL@D`tP@@N>K:t:000C S `0 A0SQy (:w9o@7o(3H0 1ID L0 `gW aW oW uWI@`pW cP^ZIPC `@rU@ gU oU XU wU@ xU uU H0L0D0@Y @`PU 4P0-W =W +W00,U` xP 0S0S\n ,0 S 8(K,(  p-0LM`0 P@Y?P 0AT  K01 \\W90 S@O9 00  0l Kpd*$ MR4 5:0QЍ/|MЍh -LMP|0| Q@@\p`0S P000CS@0St< -LM @R:Q0AS Q $0{p3P000 -LM0@`  P PpP3t0p P 0Pc `P^x!PW0 0S* yP PP  pP%!  pP P+ PP  P P 0` 00 H ` PP K0H p-LM@`g0PP`  P PP PUPp p-LMP@0`PP  P P``V`p 0-LM@0P  P$ 00u30d p-LpM`P\^@PP00S K&P@ : S I@@Kp -LM`pP@P 0A#S񟗕8 H X t H   0 D d $ \ @ 0Su0s3q0!SPPU@XP05U$ 0p03$0 KPK⸧KHPE0: S@K=P:0: S5K2P/0: S*K'P$0: SKP0: SK)P0: S KP0: SKP05 KP0#5 KP040#0#KPP0ST0SR $K;ZP$0$ 00&$ $KP3 0PKP@BNT0  Yf0  Yp3XPRlNPÉ(K 0/P ,K 0.P000v0GS(l ( ,0Rf( ,0Ra( ,0R[( ,0RU( ,0RO( ,0RIK 08`EW<  EW6*`[~ [~EW`@@<@TU mWh`bmWAIW}WW)WW)`z AIW{X VW-|2VW-|2aEAIW"pRWaRWabtAIW6s7mW3E0mW3E0cAIWs(9IWs(9JWםd @AJW6JW6JWemW3E0}W]}W] E/:h}`&w@)TVǎZ=j$ZM›X vK LyҔpTkCЪM4*`VS7ǽl[*ˏ"TM,KZ9~'}OE#B{6W`),_W Upt +X x+^NEDK`̎IZ9J}AK]{j57FR&>v&(ZvZuUE~)P+CM%+ADN\Y7W{}\i 29Imi :ēБR44?) fhUl9i;^gw6ߊ }Y+ʊ2'Lb9SVOZ2^ . ..firmware$5šsignifygrouptƬ protocolsdEūpasswdtmpspwd.db servicesasswd.origpwd.dbƮ fstab- resolv.conf$ hosts- . ..openbsd-60-base.pub . ..chown-bioctldhclient  disklabeldmesg-fdisk-fsck- fsck_ext2fsfsck_ffs ifconfig init-mknod-mount- mount_cd9660- mount_ext2fs- mount_ffs mount_msdos mount_nfsnewfs- newfs_msdosping-ping6-reboothalt-route-sysctlumount . .. dbempty; tmpF runtzlist ... ... ...untrusted comment: openbsd 6.0 base public key RWSho3oKSqgLQy+NpIhFXZJDtkE65tzlmtC24mStf8DoJd2OPMgna4u8 PCAK⭦Ph 0R8l 0 7AK⠦P1K⛦P  h0R&( l0R$ !K⊦PAKⅦP 1R 0R 0R 0  K<MЍJ-0S70#0QM0 Ѝ6Ѝ6  -1L$M80 1 40 1@00 1P,0 D P1SPPEP 5+U1<0 @ D`KNR8@POU! 4p8@P  4 0  0D0 /@00C@0 U 40p0S<P P 00 p3p3 8P PUZ@ DKr$K 4 @ @< 0-LM@P(Ko(K Kpq$S5 ?[j L5K0 -@LM`P@Q (K 0-P. ( R000C S?5"0C8pKo8@ 4P 0@ ,P S@?S00 0 @ RЍ0)m0M 0 Ѝ/8u|uMЍ/ -t0LM R`0PpX0`T0@TuPT *U@(0  000du* 0R <DP@@@TX0XP@t50T0 Hu@u0uPuTuuuXudu0@0 l0 \0 L 0<@ *0(@0  C0@ f0@ g0@0 0  ?0@ ?0@ 0x@0 d0 P0 @z .00@t _0@n0 i 0@c0 ^0 Y 0@S0 N0 I A0@C U0t@= u0\@70 H20 4-0 $( y0A@! [0B@ [0hC@ [0h@ D [0@ O0l@ O0@ O0@D O0|H`@ [0h`FP@ [0P@ O0,`@ O0H1pP@~ [04Pp@~ [0 @ 00H@0 0@ 20@30 @0 @ 50@ 60@ 70@ 80@~ 90pP5`@v [0 p`@m [0 p`@d [0 p`@[D [08p`@R(Khu,uxuxx<*@ T, L  | X   H    | < + h  , l  $      4 ( <   $* -LM0@0A0 <hZ"0S 6R"1 hL" -LM0 S(0@  00W h*,u -MLMŸŸ^P `p:"SB_  Q 0t" @TP\2@ @TNK @D@D0$ "sU2`@᛻PP@T!!^0S1`@S@TO zPP0VLA L1`@| @T fP0D.K B B!P UP0^K PE@PEZ @T DP0 0.Kl0 B B`9V @\! 0 S 8Khu(*   -3LM333@3S3圓3s3 3 3K@x3A A, $/48T#0hP0H3H#P`@@0c0 C0E0b0 3  /0S0 0C02BQ2x"0 2 a00cCR@00>K0CŸ88 00 8`A-(K8 %pPn0(K s`0xB$"C00 "00S1 @ PV 8 ՙPUX@T@Z@X00S 0\ R p0S  P0g   aR<P  eT! 0 PI000U1 $1-P0 0  1 1:0.S 0S* .S0S% 0.S"@P (0@  cRj<P  !00C0 X 00!P .P  ,X10H(Kd,Q -0LM<`00 , p B@ 0T @@0 8K(K8 4 ( @4,[ PhcEQ@e Kd -LMP`@pP0Q :x0@`0DA0 A0@0 @s@0dC1` Ach>dt. -L(M@ < P`@P  0  0{S0 R  {R0 }R0C ,RS  RS0S0Z0S# @ @0< +(Ko@0T :1@`0DA0 DA0@0<@ `@JQ <Pj `p D HP 4p 0 L 90S5 4{R00GLl8 0 ( }R000S00  0,R\ D <@P`4  H 80H@0  b4 p W(Kd -LMp0l`@p*@@PP:- P 0p_0md -LMP LK gUc  tZP?0 t/0S 0S0S @O0  40 0 W40 ( 0 dKpp P  <0 8 P  00 <0  cR <K:\ |8 p -Q   0 :S  0 0S  0 0 0 00   @  0S  00^   R PQ@V*V@@'0#0CS #70S'0 0S Z@V7p@@0 0@V``` @0p H0 }[Pe 0@S*S _0]S\0#0CS #60S 00 vPXZ@p`0 V :&@e0DA0 `A`P@]pW e0S \60@S@@L +V :BA00 :Pap  HP 0@@S000 0 =S00:00F S7hZpj]@ dş 00@ 00s03Lş ^00S -R=R ?R+R@ 0S 0ş SPQ^+R PPHS @0P@ `$sVXP  RC0S @  00\0 80 0c0ᴐp 0  %S #S=S ?S 00?0 0 pA0 (@@T@0S0S   R000 @ py80 p  0@P   Z'\ ^0  T< 0HLd*d34*80 P@ZX@  { | 0 0 0 | s 00C0 80Z Q    B 700 \   }Q 0 S  H0\ H0  N Q  R  0 0S  X R  \ H CH@T * Q   R0 B  0C ^ ^ P~ BA   rC0S $0t030A    y 0 0 \ ^P00 S Q 000 ^ 000#20#P00Ss ^q 0080 ` P@ 80 0c0 "C0 + <@0T:t@`0DA0 A 0@00P0@0T:@`0DA0 }A 0@00 @F@^Q H0 ( 40 pp0 400  <0 8  R9 0S 0 00 Q* R%80Z">_PP0@0T:40@`DA0 %A0@0 0 P0 pP =QB ,Q1 !Q *Q! -R :R90]S ?S [S}\ ~\/ {\ [^0     000 00@ {R 0@ 00 < pp > SpP(  0  |0 x p|0`0 @ 0 0  cRڄK40`00S0/S T :S000SS@/P0S +S0S -S0S VY >K  L0@ GP@ L90 00 @d)T@xT@ <0  cR<K40TS00T@00TSV 0Z00 ` ^ 0 00 00S0   00 0 )  /00 /(K 0-0LM0@P0  0$K 0 $0 ; $00`0S0@@K0d* 0-0LM0@P0  0$K 0 $0   $00`C1@@ S@ @0 ZK0d* -LM0@Sp@ Q 0 0 P( , $ :00 $ ( , ,0  ,`K,0 PU @,@$0T:(l0@`0DA0 A0@$@ ( ,0 ,00P(0 `A0 , y@Kd p-PL M`@yPT@^0 PT4KpU -@LMp`^@V`1S0PqP0 S ,$ ,0K,p (` $P )4KU -LM@ 1 eA  -L M@0 SAK p-LpMPK@`$P@I;@PcU  : SI  S @PV 0SKp -SL0M@@ /0>P @ PRD1  040 0 40P0<0 8 ::pP8@pW `e<0  cR<K2@ Q0/  @<0  cR<K2@ @8@ |P8 `0 ` PP PU80 (Kd p-L M$@KPpHI`  U 00/S  00 (0008I@PKp4 p-LM@`P0=S\ *SZ +SZ@I I000 `0p -0LM0p@`LIPT 0r03X0S  I 0 0 @ PT d -LMpH2/@bP@pX   I`P`P 0  P!   @P 0P, T#W$2PPP  00  U@!a @T00S@ H@P 0 9P 0 00 p60000SN0KI TY   I0@0!00@00 00` 0PP 0T P 6U  0000 dSV\0P 0 yP @0 @  '1< *4u̜d -LM`pPH  @0`;0 00 KUGv3L0 00P;00MЍ -LM0pp`00h p@0PPY?0D0<1 @90000Ęhx 0-LM@PG (G@P {0h0MP R00  0AS ЍЍ/* 0-PL M0, 0 0 >nAF/( 0$0 $0S  ᬫ 0S(0$ Pl1RhA@`0 H$0SG $O>D,10 0 ,@P 0$ +e10 R$, 0PX , 0 0" P  0 03$<:t+$>p <(0@C`巻 04K0dT\d -0LM  40  P00 [ 0P0K  0 00S  0F+?0S I00SG? PP?  A'8 0  8K??#0S# 800S $$R'UO 6<o 808 0S00'<P800S8800S 800;0 0 0S00S 00S T^ @ 0 0 @ C0 0S 0d K 0 0 0pX` \>$Q `X(#0S`0 9P2?P  eP8nP000 2 lP/rP ) sP'PSP  @ (  弯   `  /Z YAl'#p00VaP 0SR  ( @T 0S =pP 6P&00c  㴀 ZZPY0S x]Z   P@ &X0V00&Vk h 0 40 0 408 0<0 pP<  bRڜ!P@   0 PpᮜP`g 0  )<K ^00SY)<0@  cR<Kk!P Ὺ8`0 $00C0Q 0 ZZPYYP0SrZ^  4(P p @Q@Y P Y    R Pp X0~3p Q5 h#h3^XQ``H#H0 0 fB!C -@-@ PP0 d ,0S00`V@3@#V@TP)l2F/PU@yP pP^@@ ,Q00@T`3`#T`V).pYPͫ0SB P70P`8@ 7P V` W,@TPUV"Შ0@P 83PU W 0 P@T UW 00 KPv -L M`Pp8( K)V`U ,K:@P  (K, 0!F30@Wp Wpp,40#00 V  @ E 00CS0<0U@TT0@0P  <,@T(K  KTPvĘ 0-0LM0 0P@  R 0S^ UPR 0SQ\ 0 @@<00\, (C0Pv<8$4,< -LM`00002p0崢SpPB0S @ 00l30@00U 1P0@`00 @Q X Q  00\ 0020S+ 10S' 0S$ Q1UP0p;0QP P@I  0 0S0D 00P1P 0S0S0  (! 0S0;0 <0 R 0S PP 020 53,0 0P@ h00S 0S p 8h " 0S (00S U &(K<ppv+tvT\4$ -LM4@K 8 pD80KPP  0 38! R@W `8@В S2 `R 0 @T!V @{W M? 0S3T20S 0  <2D ,$20S# 0 2p#P0  1!4K ]0 1p@`@H0 0!0000U00 0S74P2HW`# 00$10S  1!00S @PP @PrH 04K ڣ8 =ZW@ h00S0p >0c@4K (KT|h.Ępv+\Xvtv -L M(PK@p  `T`00 0S 0S$ P (K $KP 0 S   $ R X0!P@ @ (K@ T0d0KPvT -LM K|0P 00 \cPuK t}@0 K@ jKTv 8P p-LM8@`P P PP@Tp -L M(pK` PC$KZ@P  :$ 0!f@  R 0SUUP@qG (H@(K KT-08 0M0\ 0< 0S 0ЍЍhv -LM@K <80 R 000 KTv -L Mp4  @:0 K$`V00@ʮ`0 0000 D0S4 $P0``:$PU00tP媮P\4 R 0S A0@ 0$@,00@ 34 (  0000003@ 8`P3`[0#40K5됣@0@S 눀yPF0#ST 40K G ҡ23 0S 0S 00 d=20SX 2Y0$'33 iTS   0K ]T20S  HBHHb .@DT 20S  b 10S s. o.O L`P  *"1@p!@l1 @@@U5d/ 4do6+  C1P". LTK0K4K0\8 L4K$"0X@` X@hp(RX( +!P)0!S& !0LK0 0LKɞX@LK Xd6L K@hp8S T!3`\(0!' X8Sd! !\H`X00SHp(R 0x R Bp0x p0`(0" X8Sdd Pp(R El8( S,0 dS \ӝ(K<ș@lLX3 x\ <t M0ЍM 0Ѝ 0-0L MPP P/)@25_0  0 ◯PPp@ x0 t0 @ᙋP. 0A<0@ ,Y2\50K0Ȝddhl p-LM@@`ủ0DSl0P $<(` <408`B㦧400,, ㌝p* p- LM0PS0C0 @l0PT``p 0P0@0 (0@`000<0 00pv* --TLM<00 00CS,000 0 밙* -LM0@=C00  ]d 0-<0LM0P@0  s@= 00d -4LM@p" R 4|0P 0S R$00` ` `, ; bR,P0V0PP 4P 3 &0S0S 0PP05Z000 3됓,, e, P   0  $0S0S (0R S 0 ,0 b cRIPLP0S V@ 20S 2  <&0000c0 U 0S 0Z0wZu \0S  0S 800S 0S  *dY 0   0Q 00S!000  D$0 <00$ $ $@G 0 0S  Pr T000 <@@$00$02<00$ $ $P@ $0 0$000 0<0  0R <@@P`0 0$0 p8h0Q0 0S 鰙*<ę*tȜh.da $0 0$0 >0S    奏K 1  cRKn p" RD  l < @ h P  4 h=0S t͟!Z  0$01  K⡚D  P\P ͟0S0@0 @ TTc Ta !TPG00D-T S tV x,0 00Nt L,0 00KR@K`h, P\P 4̟0S0@0 @T T T T@UYKu K0P;0QU 00!S 0(000 0 0< Q0[S Kₚ K0@P@@TPEZ[Z92`6  ,P KxP  0 @pP 1  cRK p0P  p0S|ʟͣ` 0(10H0 000<0@Z*Z ?Z+Z !Z* P\P ɟ0S00 (P@ 00 3'Z \ZR "Z( 50 Q0S00H9 08ɟ X  Kp0p2 0000 X Ka0\Z `Z $Z> P\P ȟ0S0@0 @$T "T  \T `T0  @p   0@0p1 cRK pT{  \00p@q' P\P ǟ0S0P0 cP(U3 P\P dǟ0S00 R(P @0T K0 10c000T K0 000 00" +{U0  `PPp @T\T hƟ0S00 @VM #T`T 0  `N00D S `J:00B00D S?[T0K3P @@ 1  cRK` P000S%⏢l5 @T\T 8ş0S00 @00D SV 00p P\P 1  cRK* P@ğ0S00 :P@00 P\P Lğ0S00 p%P#P 0 X K& 0 @ PP0T K 0T K 0 l00@1 0  Q  @1  cRK @T#P P\P ß0S0P0 ?P 0000B S0  P p #00B S1  cRK p 000XPp@000  #  pS0 X K000000 0S0 0 BR CC'Z1 HX Kq  R" z 0L00p0C00  7"Z1 HX KU0 0SM \ d \ (Z "Z 'ZA)Z \Z<0000C040 0 0\0000)0C"Z00"\Z0 Z R " Ag Re`W Va0S^000C SZ6⟟V0P00C >Z00007 P\P d70S00 Z >P00 S>ZP$7 P\P 70S00 -P0 0 &PY000 |P00X  S @0000 0 L8EP^WP00(Z  Z &Z;Z |ZJ8 P\P 80S00 < P ;ZȠ4 |Zㆠ1 H9&ZK,|Z&PF( "p 6 0X ,0! 000B01 1 0 1 P0` 1cX T 0T 1  cRKzP@` : P\P @0S0@0 @T0S TT 0`!۞0/ 2T @ 1  cRKBP@  P\P 0S0@0 @ T 1  cRK&P@ 00C0+ 0\l:;0 *;0S; P\P ;0S00 (Py w0 !`yL0ASb 8  @00P  PU hLA  `2U000SI " F D2P   @P  <R }R<< 3&  ( (@P 0 @-  0S < 0S (@ 0| @000 <0 = ǝ`U0S -,0 S 勓(K0MЍ/v -`1LpMP` @T<坝0嚝PUAP+ `9:apP0T\S `%R@PPD 0S?H@P x㙝K@`PWP0: Sl0K 0@  `00PV(Kv4< 0-LpMP@Ct@d 0T KWP0: SX0K 0@  0@ 0@K0v4 -LpM|xP ` `d PRN0SJ41`PU$'PA 0Q= 嘠KpP1 W`P-0: S)T P0 0lKS0S t0Sx0S8' @(P RX%l0K 0@ pPU(Kvvvv( 0-4PLM@ 0R_b@T0錚 -$0LM@@Td p-t0LM@` 0S P 0P@P@U | `@T00@pd -,@LM0 01h酜d p-h1LM@`0S  0R (, 0S P 0Q AAP U 00S  0S&PU0 0S 0 00@CTT *00P V XD05V P0   phd<8 -T`LMpG#P@pP0 P000Q0@d -PLM@ 00S PP@ P 00S 00S B@lpl`P0S 03nᐣT000H00<td -LM@ D @0$ 2   0Q0 40   D0 S 208 <0 80S2  2Z@P2 T'04J 80S TX-@2 0S @00S00S@ 00@0"@ < 1 S< 1  haQȑȡp!0S P@0<0S0S@ @ $0$000$080S l1@N@@P5 0S400S 0S 400C40 40S @0 00S 0SSP @0pDP @0$0  < 80S 0S00y0S0S<0 0$0(K<dh.*tx 0-40LM0P@0@PP0hd 0-L$M0 4 80  00 , P( k 4Q14 0  $ 0 0 0$0 x1t@P) P0 / 0S < 00 0$ 0 T4E  1;  80S 00S2 4Q 0000 0 P 0(, @ 0@ 0S 0 0 0$ 0 K0d -LM/@3P@P~P @ ~P 0~P  ~p3  -LM 8$  p/"NKG/8(K Kt8tX@))dXD 5L4 1@$ -0@ (PPX@PTg7 0kP @P `Pr$ %T'7@   x}P h}P  P0 D@}P$7  ('(7  7 @6T! P 0P+(@P-ƟƟ@0 @(&$`('0@/SKSPxAKSP 1R 0R 0R 0V^ 0S 0S6T  c%+U@#%# W%P0S0SE#0 0S| &<l5PTU X喏P5QL% H5H #0@ 0S&#|P40S&|P4 %y40P@T0 08Dp  0p`PN20S 371PS00@S`!RI $2V @Tt3P  00P  3p @1双 .2` $2 s@@3P 0>  0P 0P @$@$0 0$00000 0AKRP 1: Sl2 0S lTBppP 0S $1 F@bI 1*彘1 00 00Q $"@0fA 㤙1!0`p@@P 0S 5lA 0S  0e@T 0[ 1@T 0  0S "%0S  0DPH"%PV ,0  W|0  p 0S00 >(Klx4d̜<5T*Q 8,Q*`hW șp0dhtM X 000  R0000000S Ѝ/ᰚ - LM4<0<Q808 RT T;0;@80 (@ h갚d p x |    -L LM0@p0@`PNj00eҋ@Pw  0M 0    Ѝ/ p-LM0`@R0 000 Ps0Pf 00 p p-LM`P@l0lC@VPP8` ᄍ  phMpd -LM@}. P  u.P -LMPpZ N/0#SJ/@PD/@ {z`P -LM@ ?+Pp``V 0S  f/+@P@Pf Yp`V:00@j -LM\p< @ D0 @幖,18 < PPPHTX` UU0PP``ї `PUp4 0p W8 <0@DV .T 0.S  0w/S2 W/@/000 0 bR@ f    分P@'0Spp ( K0 $C,4[/S0j pP 0TU ,0 S (K -LM@ᎅ0 0 0  0 700 $K$0 jP 0Q/0000  `=Kd -LMpPP|0PPP]l`0V\@T `!@0 U 0U 0hƎ*4d 0-LM0@  0  $ 0S0[ '$0 0 :Q0a/0 30 0 P  0h 0  -LM0P p 0S0+ &$00j  d0:00  X = SU ,0ʎ@0  d0d0 0 8 @0`d!. 包P&0S0 0;0& 0T$000  qQ000``@ V 0 90 0 0 090  -LMP pX`  R 0PXX@@ 0 0 d@d0 @T8Ip T$Qp Kp`` P:&0S0 0;00& 00$ `` V @gT   0 0d0    0-LM@PP  0h0 p-LM @Pu9 0' 0PKS0 `K %$0P0&P%0S0 0P;0%0$0 壄P0SpP 0 0C0P Kp (  -,8L8M0QX ,0 \ P  C K P H ` X0%PPT k  R 0 B 0P XP  P .Z *Z  Z #Z7 +Z -Z2 hZ- lZ# 0Z+A?=;  85\0\0  H0 \ ,H0SHa\ T0 \ T "0lSX @  X 00J S  0 0R00C S <ST0  AH T X XPXP  ZX pA0J0S 0c0J\L S񟗱P dN P P P P dN P P P P P dN \N P P P P dN P P dN P0 @\00\0 `  \iZdZ \ iZdZ \ Po\ P`oZ6 dZ iZuZ xZ= pZ; `pRV0H0 `pPu`H  0 0g 0  P`uZ5 H0S-0+0, 00g)`p1>A 0 P` g 0R0  g3 `p%2> &B P0` g P Gx0X000GBpB`  g L0SLŀL T \ L3pWp\ x \0CpK\ C0KCKCpK(4L 0#0P0ST0 SL `pTL `b j= S`fH-P+P P0S ?0C0 0 0L0P0CpL0 P 20P00S )0C0 0 0L P0 B0RL pP0  0xS0S 0C0 0 0LP A pL P  00V 0P R 0 B 0PUP00fP0 `LQP0S 0C0 0 0pPU*P L0 P VP R 0 B 0PUPP X P0 P00P0 ,0 PS  (K<  P  --LM0 0 K 0-LM @P2u  50 + 0R 0S$  sp  0R00 0  0QS 0*A0 0  : A0 PA 00 0P0\  -LM0@ < 0S0   3 >#$00/  2p' 0 :0  P &#0S0 0S0:0 ;0#0 00$ 0t  -LM @L 0Sp 0S 0 0C 0   -LMP @T0pD ` 0S p' 0S V0`!  P0 00c0S@@ c|pW0 X0 dP0 ``  -LMP p?W` 8 0S7p 0S @V@@ '|0 `d0 dV0 W0;f   0-LM0@P  PT0  00  ,׉0 0-LM 0@SP P 3m 0P 0P 0 0-LM 0@SPP mPP0 ,  ,変0 -L^M\Pp`@ T00\ⶉ@|0W0,B0BSV@`ᨉ[p0 F 00p $0(`pp ``` d --L8MH@K0B 0 0 ^K -p-`P00PQ0 L8MS P 0\P@K0 0  0 P<Kp  -LMl`@pP  PP@ P P@@*U 0S (0Sd0< `0``0$ p    u  4  -LMl`Pp@ c PPP P PPPT V` 0[00\00@0h00 0,0$ (` p ` P  # T d -LM@`l0pᴈ00 0,0< (`0P k@P T00ӧ2  `kV@,f0 Q00 o+dMЍ/ p- LM0@S`0@0 Pp 00P@0T:h0@`0DA0 㜈 A000 000 0 00 p$w(wd* -@0LM@ <  @     d p-LMP`@@P`p -P"LM0pS<2@Q00@A2 P 20 S T1 T1P``BTR5 1k6T(P``2T)P``,0DSTEPd100LS T1\L1L `R`? !`P1  R`0rk`p`3V) 0 T $ X00` P@0T:t0@`0DA0 ܇ A000 000 00$w(w@d -1L M0 PPP0@  Q EQ Q P0P0 0 0 0K.0R S P0AS@KKK0@  0(wt w$w , H   -LM0Q00 80 00  0 0bC1!0 $w(w 0-@ LM04@S0P0P0 }$w(w p- LM0@S 0ES00EPPP!`0P@ @T@@T000 0L 0H00S000 00RP4 5: Sp$w(w@  -LM.@P* P㨀p`% P)U0s@0mPP 0`|S006|P00S 0 $w(w -LM`࡟p0 PP  P1T09PP1@p1@`1T 0T P@100(1 P00S1  $0 < R 0S UU* &P00FP  R S0P;P@ @V` W0 `p 0pT0  (K$w(w 0-LM PpP @0S00,t0P 0PY@P [@Q0 @@0$w(w 0-p LM0d@S00 ^D0P {P}P 0^( @0$w(w -`0LMX@00p`0 P~ 0mX같w -LTMN0P!0 㻅0x 0 㴅0@0 0 4 8 婅D.D0@S0l P0,P>U0CUAU {U  U. (U=U 0UVEU! ʬ=U 0U=U 0U- `M`= x4  | C]@@=| 0 p0 m0|04 80Q0b0 @S<$0R@ P EP (PpYx  0Y0' 0g0S#804 0b0S,L0S0S hP hP |hP whP|, 804 0b0SK 0S  P l Z :H @g0DA0 A@pl@ H+008@00T:4@`0DA0 ̄A0@0@ 4 80 J80  80 o:|N408  c0S 0g0S d: YM0BSJ 0g0SF0:) L40 | x A p () | } 9| 0`0098@`00T:4|9@`0DA0 pA0@0@ 4 80 DY| 8@ 8@ 8@00T :40@`DA0 SA0@0@ 4 80 )80 p  80 8@@0T0 80KP0 8| H0 8TKD0 8 p@0 8<0 HU  @|  \8 P`8U\\eG<| 8ȟ7 0@PX@ @0 `@ '@0S00 X7P`\w@@P;PD7  6U : @f0DA0 ؃AP`@$'00䆟P. P P;PppdU :6@f0DA0 㷃`Qp6p0fA0 㬃|0 p|@6X`  06p&0`P0@ 0 | |0 p,6| `@ |  *5|@0%05|ş0P\0 0S@\0d@ 0 5P {P}p  p%p 0t0 h0 mD0 0L`0pS0@@0 (PP U :p$@f0DA0 ,AP`@t00P00|P  U :@f0DA0 `Q@#@0f0 A)60S0 0Wp@P  hQh tp php 0S00Ap@P |t L3 \@d p @/2C0`P0P 09| |  pu|0 B` `P P0@P 2]  0 0! p|  71 p | Y@:PYlx|@ x  0x0 c|0 |@0SS88@00T:40@`0DA0 OA0@0@ 4 80 8``P40 `A 08 =l| Z : @g0DA0 0p`0 g0A &|0(@4ⱁ⭁|(Kd$w(w @<T\` L_ <_ d 4  w   -LMP@| 00 =RX6 R[<1@P0U0`0 { 1  岠00Pp-?0 0@ὁ0@w0P00P00 :00000p00p@`00p0P 000鰚$wd 0-0LM@0  PP |0R00PL@0S PP 00鄙w$w(ww p-LMdd (\P`0US  ,0`000U 0P@TpԜ4,M !2"0SЍ/0M0Ѝ/0M0 00Ѝ/M 0P0 000CS0Ѝ/ p-0LM0`0 P @1S0 0 R@00 Q@eDA 01pd ~ MЍJd -LM0pPP `0@0A 0R3dP0T@@DPU -LM@ 0P p奀0` !0S0P tW ` QU 0 V0 C!R  B0SP00C0  Xm -LM0pS0 0  @0H0a  0R cP' V ``FPU0Sxl Kv@000 @0 0P  q00C0P(KR M   ЍhЍ/@ M0S 0 0 RЍ/`M0S R 0S0  R PЍ/ 0-LM0@ PT 00 Q  Q Q0 000 0000 p-LM@`!PPP- 0  ( Kx( 0R   0 00  p0 0S 00 `0D`S 0` (K(` $0 0 PKp,w< PM  ЍЍ/Ḟ -LMH@1 11!R 0-<@LM]0 ! @T0 1M0 ) 1Ѝ| - LMqaQA!Q0 0 $T(D"Q @ TtPa4p唂000㜠0P@`| 0  T@tPa4p唂@  `<  8  o3N4z,w 8w 0-LM@P }~0Ũ  0R 00Q00S   @0 0S0 00Q00 000 0h4 < p-p0 LM `0`@ \0Pm 0P 0S 0S  @Tpt|p -LM pW`   @ 0 ,0S !RR d@<0\0 P-XP 0  p }0 00Ĝ4 p- LM@PT00Px0@l0l@ d0m 0S U 0 0S @Tp*t|p 0M0S ЍЍ/| p-|0LMBP0`@ P0 L00  0S40(00S 3/`pt|p -LM0P00C Sap8,KP6 ,P3 P10b/@T( X P% sP P5aP sP D MaP&aP ` V`$K p-LM<`P@TP000@ Pp*| -LM`PP }@T}0S@ }@T}0S@} pW | |||@T|i| -L4MP@K` B 02p`0P Sꨎ Ѝ L L $ p  7$-(P(0S$ ((P0S))$ {P @0TPS@}P(|PKK 0-`LM@P^$?@0S^$?0h p-LM`P0@ S* ܏ ܏ @ @ ď ؏ 0P@S 0P@SPVU@ P@0TVU SPE T>p p-LM`P@e?| ph,n -LM`Pp0`  1|0 00  S00S0 PcA 0P|0 @P0 SP@00S00 PcA 02|0@P0 SP@0 X0 @ThA 0|{ P000S x 0S r 0S #@T @ 0 o0 j0000(K -LM`p0 <0%P0 3TP0 RP& @;P NP%dP cPsP uP@0S@@0P S  H | Ȕ ܔ 8 L d p  Z@ `T"T $T\P$(0S=$u(r(o0S)g)"b"]$X{PS@f0TPS@}P A(|)8 ?dPPPUb^U@-00d&0S@PU 8C80CS"`  , , d | ԗ T  8 H | ( @T0\|%@h%@T0\8%@0%P%0 %0$x4R0 0 $j$eP$_@\00\$@x$l$0M0 SP$0E0S 4$>@;0\#@$2$0 f#0(p#"@\)|0\#0 #pW#np#0@pP0S,#  04#@T" 0S#0" "0"= R20"""0 "& |"0t"h"\" 0H0R@20 0 $"0" @TM0 S@ P00S0S  巭!0w @PTR(  $0  ;P  @@DT T @D W p00P(K(4<DtpLlTX`ltx|PX(08  -- LP8MH@KB  0K 0 uK -- LM 0  g K -LMp@TTP` T TT  T30# 0R 0 P 0$0DS0 D d  4 t    !  @     T 0S `  \ 0D  80  0i@DLPT8`X\`p -LM@P[00+ -LM`pP P[@P@@'l ?PPPP@th2  \0P lD #W ,U h}[XDd+\-0MS(0 00! \00 C00 RQ \0[S  0S 0 [S ]SQЍ谚 -LM@P 0s3 -LM@P 0S0=SM0 [P 0P ]P RaЍ/ -LM@P 0` 00  R0B0 0 PQ [RP@鰚 -LMP pm0W:0000`$`V 0S0P@  w@  m0 A?V0@0 p`P -LM[@[P 0 d hdMЍ␆ -LM@g P 0dw -LM@@P=ꄤ 8 8 8 8 8 8 8 Ф @w0hK0 x@P Xv00hh7@ ,sP h鰜4̜x *Мdw -LM0Pp v 0w03&@  0` vv@T@ 0W<0 0 h! -LM@` mP m0p0v @h=00 0@@0c 0 h oxv -LM`@l0P  0SP1v p ? 1 00 @P0Ps 0d^0a@ 000C Sd!`!`0n@@0s 0@00S  0 @ 9h7 r 000 R00ӑ R \p r 000 R00ӑ R Kd$ P l 0<0 u00c0<0j 0<0l00<0X00<00<0,0 (00<0tw|wĜ -LM0@ `P h   00d R` 01U 00S0 S XSxS   00S  p p10 0@  00 --R) #R \00S)$\' pP0000A S00B S r 0P0W B 7 BR00?,, R^l(K*@P0S |0d00ᎅ\ @000H00 S  00c0(KpwXh\L<Hl -d0LM X0@P0  'aT b `$0 0 0 h\dLHl -LM(@0S j ha<4 -LM7h鰅 0-LMP@j0hj4 -L0LM 0@S  ,@TT^@@$h< 0-LM@P \ 0 00h p-\`LM@jPj \0 0 p4 -L M@Pq0S aQ 1P@@]QP 00hA$0K 0(0K0p,0K0 p0 岀`PrPB1 $(@ $0P0,0AP` ZP U APUPP|00  (0c0u03Q0SP0 000H0 @0 <08040K,ww da0($4 -L$M K0 K K$K K@P $  U K -L$M@PPr0S 2P 00S hbQ \2@@LP$MPH L 'TΟT>H> @>P 8>8N4>4n0> ,> b$.$>$Ο >LH0 ^#PP@ P PPP0K^= 00 LP0b-P]0 a0bM 0R 0LR M0L-0ldl-gdPMT]  2Z .Z= =0  c= B = =夬=圜<~̟Q  P 0 S< ~pP Ro L 0P 0P  ~ U%}0P  Rl ;0 0SP Rw 4 x x x ˟^ P+000^PP``0^XKX; 0Q0AS0C0 0Q0 0 0ӷ0C 00· R 0S0C0 0BL c0  &0PJ0Q `  a&0 ` a :`0P0@0S 0 p a& 0 g0b 00S0b`0pt0 S P00S|9` P7 P/ P6 Pl 7 P1  P2-P P-9R` `P900O d)a0`ɟ000L)0cSsS CS@,9@<{B8=9!0S 5H0 0CR,8` ^` 0  c#& 00 0ȟ0 `0S 0P0 008  P P pu0S7 00C0'P P P@@ 10@'S7@@ǟ00@007`` P7/U0 h ` @@Pq0 S86@0( @@X '00F  0^0 PL]0000@ S|6xƟ 000C00T&00L6Pv>10@L&S0000@000B &0 0P0R &00( \$00@ S 0 00C005 5R00ş%000t% 0P0, hş00 60#P0%005 P P``]5@T0S @ğ0 ( 0dX00x$0PP@T 4 D4 @ 00`0 0/@v0U3 $4 0 UCpD0KS`0@P 4p 0GP`w 00` 0pGWPE3 00a 'R 00|3P <3 0S B0 0 Rڙ M0 0-0 0P UUB0 0 Rڂ ^0 0@0% 0  0 0Sp0 P 2 000S S SHD$"00JP= M5t0S00&!@0!S0@)P P p.0S @!0cSsS CS,1HP 00{ O{ M{{u @L \ H0Q +$H 00 (K8,40(H$ww,w*PTdL\4Xlthp<|,<wwww x wwMЍR p-0LM0Q`0 @ \PK0@ HT?PA PT  |7 t05@K 0FP H7@n 0 S (EVKpP\(lE8 -0LM G QE -AMLM204 ,0 ßp BKpIhR`I*X;cP! pP bP v @ DP 00$R 0ʂp`p`4!垱pA4$00cS<Z" ȠP| Rh 㶱KpVP ,4[ S (K0@4P S@ = 㡱BNK@DQ@D 0S0  )P% PZ c06PP 0A7VQ  P p+VQI"lWxC ED@EMЍ -MLQ Mp,   S4W p.l2P: `PPT P20S ߬KAp(%hV8: SBNK@D@D \P UP 0@(K 4R SdB BK1AA0+㽞P 0S/ 810S+^KPED1PE0<+㪞BnK`FP`F*Q U@UTBP QQ~QBNK@D@DwU 0p8MPtkP ,0 S PT(K$4Ȣ@HD`|0,$<X( 0-LPM@P \|r0ShP\  R*Db00 0 0 K0h| -LM<80P>$ R0 0 0mv4, -LSM✠0ZK ( 実pt5`JKP@  04@km( 0R 5T$K$,td@A8 -0L$M0P0 ,S 0,SS0 afS nS 4@K T @݀0PS 0 S SK  D -1LGM0P,0  BKHIKpH@`I2P-,Sp+ 0,SS' g ~T 0EKpP  tp]@PA0 BIA|41` Vڠㆀ@0TS1!S00Q0S\QP  ,0 S S(K0DXlT p-LM`PhS0(0PX0,P04@000000`O00$0(00 Kph,, -LM0@S`0``Pp  @zlP U0SR Q -LMMMNnK`F0`F@/㸀K,0 PlS[K gS cS "K_S KS!0p  ,r (2 $ hP+NK@  0X"K0 S0OK,2 L0L (2 ">K$ 4 T T G @ +S O"KOT DNK@z, 0R R(K$,(Bh p-LM`.NK0P/0 Sh00 2 bSP0 H P 8KJ 0R RKpԢ$,'Bx -MLMP30PQ H(0 p4 HPZ  TP T CT cT00G0UCTUCKHH/R2CT t2$Kl2W`` 0 @V0< |! 1 匡 3 ZoK PKpR ~R|1"0|1 0 t1 lQ xq 剝@P p1S 0!t _RZ?Kl1 0x1 0t1 3W00 S.  0IpP 4JKAAp@?0 {?@4Z_K 1 +R0 @1 0d! lQ xA t1 P2)Rş5%{i09 (K0`PK8C8st@K `K$NK0QS tK$N4SX ` h p H x d ddddddQxt t$t4Qpp C?KK X$M3s3Sp< s3Sp4 4KK00 KS FC0@#PMC^ c^  K`KKtK0K i K`K tKpK0K php/P"Ÿ09 06 06 9 $ (7 PN P 7Sx      h xb tb pblbbhbbbK "$7gM3CS '7 K@T"T2[M2 K0GWS B0@!PIM"(K2 0!<Kt 0 S NK 0-2LM0@/K0 N1 0gR3  aR dRmR sR000 0  <P00 `H{X0 0aS 1KP 0 ,:{3L0 3H0 1/KⴙPP ;K0gS*T0@PKS S S D0H( c@K L0LP0S@ S@ S@ S@ `@x@ KVglSg 0 S TNK0Ԣ8$,*BH<3Tt$l| p- 1L`M0l@KP P0 N:;P) @@.`;P @pK< sp\p@K< @dp\K@;S2  X;P1,/M 0 ;  i I 嘘P `p0S.S  .SP @0S 00C S000C 㓕)]I TP 00C S@0SX0W0Y0 8K8p 4 0 7wP b(Kpx+ CMЍ 0-LM(@(P( x tE Qt 0-LM$PK0  @0 $@ 0P4$@ 0 jP lJK0 -L$Mr0L S`P T00@t2P@l@ L7PL4-7pP$l- VPH  0H0 d̑pKP 1 7@P LlP plv7t7Oq7H0S 0  4 d0;010S  XcP _l\00X>P T0-SX0S MlDK 08K,@P p=l/7P 4LtP L/l(Kܢآ $4D -rML M<30pKA(0 P 3QdKP`20S  BP q'20SN 4PI mKAAPB7`K f. [|2 RpB@$P 0<HPpH<2<0S 00CS00@Ӥ0궈@aQ0S 00CS00Ӥ0ᡈ PpyTYTQ ፝PL 0S  lk3D7: SfNK@D@D P 0孤#KjPzK6P堤mKAA9P6: SbPP ekD7: S-K  B ] (0 S HH$K EdaD@ETdx\ -GMLM20 r@`P,0 fP`P iP`P !6p10cQZ1pI aIKA P 4: S ZKBNK@D@D+I(!P 'uHp0W`/S/00p`.P/P@ 0S @P :0/S @P:0/S@Hp 0S`  BK APZC p-LM 4PK*"* 0 ,@`Q(K c\0jPPP @8jPV % !PP o0S kjP0<0Vac 0gPP UjPQ0V0X1cPX 0DIPP ?0-SX0S $8jPKp@,h| -]ML M0:0p@,0 ::D3 :A/jP+#H P: HtHP 0. 00 0000IK0A pP0S l *4: S  X @I@ < X 0 0Tu OKA A5: S  %  P  8VK0]K5 8B.K0@A B⨘5 @0A B5   & 5 &40CS$< 4< ; 4< 4< ; 4< 4< ; @E $庢05 崢QF <0S%Q$05 ! @/uP 0S @P :0/S @P:0/Sd t4P% % 0$ ``/Q @ 0T/S/00p0a0 Sp M 00pY p4S00?Sp5: S}HPv0Su H0D{pHl5 S h5S d5S< :H00: SX ¤ S0: S p5: S " % DH@: S'  SL  S S  SV  SY0|%@Gpl$ (0K T04BP7尅P0H$ 0S P$ p5: S $4奍0SpP` PP0S$P h tPT -儚8@0S<P$0S<3P  3p` HT ;Q 05$#8#0S 00CS00@Ӥ0 z C@40S 00CS00Ӥ0 f / PpyTYT '3z\ H ,73p`4$"hS0 P,5: S&Z <"@2 P /0pq ! Fp00T0S l\gp1($3@PpT00 S 0 HPgW22Pp22P gW  彦PP0S'QDus ,0 S D(K@,8,  QE,@E$aħԧ\|Dl - LM`Pp)2 @@P0/S /QP@0.S0S .S0S pWo 0S0 P@T0SN E@1 hPP? 2$0BSF ,F ,F E ,F F F P% @B ?0  0SR R5^IP 0S `g`@p`@P0S ,9ἢ0 MЍ% -0LM P QE-0M CR 0R0 SЍv00Ѝ -@㔢L@M`Pp NPP sP p MP@ D"廟pp=W&RDK4KP@ 0 K 04 DP `P00000 #:@PpW0S@ 0 0 4 ``P xlmp` `K @pT0\ PR0\0 \0@`9K,0T@X >\P <\00S \ 0   \PPcd80[S  9[0SYǟ| \`@T0VU L00S@ D ,屟(KlW8pxDE MЍ -0LM s QET -1LAM0@Pp` 0 sPp  p00`SAT CFP^K@P `W ."1P@K\ 0 S CKxCtL -@LM `PGC CC00 Q03*0  000 pW00P0 U 00 @ep 0 CP02@0P5 :0CP *0@@00 PdW p(K@0 0-0LM0@P0 ) U|@0P00 UK1GH10D1P0 @@ :6( 0 S BK0xU  0-0LM0@0 V)|P0P00 UKh1H10D1P0 @@ :^5( 0 S cBK0xU  -LMp`0P`-@P04`0*0  0 @ep 0 6@P02@0P5 :*0 -@P $*0 @@40 PdW p0@ TP3 : 0S 0 0@ 0@00qU dP"(KD0 p-0LM0P`@0 & 0-P0P00 VK*.L10$H1P0 `` :c@$2T@ 00@ 0 S ?KpxU0 0-0LM0P@0 %u4 P@UK-H10 D!|0P pp :"@ l2T H0 @40 $0R0 Q >K0xU0  -LM@%,00  Ph|UG-M T 0 $0@(@ P,P`0`p 4p@0Tp  <0P<` 0Ԣ($ 0,($0P00P4@ h ! @(`$, <@0g\ P. 0@!g.,P(@T<@`0$ 04@, p$0( 04$(0Dp4pHXLP @ @0 ! 0D!0D Q18 P!D`!D08P! LPpHI$PDHpf.. 0 p 8D0#Hpj!E$ 0#j 0P%@DX@ 0H @^LP@D PpX  `DHL@PPT@00P0 00 pD0 00H000000000 L@000 PP`000Ѝ"G- M0@ Q0@0@0@0@0@0@0@0@0@0@0@|0@t0x@<0@@408@,00@aAq@P `(p08! AQaq ,0d481Q   0p^P0Qp nx ^Q nx -;xP@ x ~ #;xPp x ;x0P0L0#,4 #(< 0 8 #D L0 @ H H #",#,P T H .(#X \ H "D0` #?  08^P0Q8 n@ ?^Q@ n@ w:@P@ @ n8 m:@P8 @ g:@0P0D0#<40 0 D08 #8<0 @0D#\#.pT.l4[#4<<[0@0 @P劐pP0(Ko: 0-LMP@ 0#<00#800#400 R00h6 -LMpRP D@A1>08 `cWP0>: 6@1@ T@D SH0 0@H0L@pf@00 @TpG†@0D@ S H00 @H0L@`W W P 5@1 0S@DR𯝙H0 0@H0L@ 0-\0PLMP 9@0@0D@H0L@0" -LMR` D@A1>?0 @PcXPp0": 5@0!0@@0D@es q@00 @@0D@@H@?X X P d5@0!0@@0D@ 0-D0PLMP I9@0@0D@0# -LM@ `$ PTp 0 06P0 S | p K'L1 s400qT10L $0 S 8 K#QM`0 S0$00DS$0 0!$0DЍ/ -LMPRp 0&#`#@P 0W0 0P0 X )P4 U\   8@0`P\0##@&x -L4M`PpP) 0$K P$ $0S 0"S UH@K 804 KLP,@0u("(04"48#K -錑LM`0 W0RSd0 S SMZK hP0U UP SBU U8p Up 0-l0LMLP\X@ TL 0x@>p -L M`P`, Kp 0 @P G(0,S`P"0 0<0S0P0S0 @l  h dP0P@S0P0S0 P0S0$P0S0 (I,0( 0cR00 >  Kx -L M@D@\pP0@  K0C*KM8l8a-KK( B0( .K B( .K B( a-K( B( +K( B( ,0 8PC:K4 L((0B8 8 C0 L((40B8 0 S 4 8 4 4 4 4 4 4 4 4  40P0 P 0000 SL0SRL0S 000 00S00S00  0 00F0.V S:V `V< KAP40p@P  =p <K p4A5Q0 00s"p 0 (00?0bS fS0S4 0R  0A :K(45<K 0880S 0Z9*K0P8n L YK04`<( :KXş 8pp0`0FPY@*K( P:K(AP @T *K({APK (PV`P K p@ *K( ap @T:K p`K@V@4a0S 8P 080(pw0 0S$0P04 $`@P :K 0K:KK00C0K*K0S"+a}K(pG]*KZ2`VPŸ0S SI, S SD4Z :*KAP6:KL"\+0Z.*K3P(:K p!K ZY *K Z Y  :K \p K00C0K0S@$T0 000090S <L :p`0 0+0S00S 0S4A000 00 0P0S00 00S041 0 -0 000 000 0` ,0 S *(K$dJH% -LM@`pMP 0@ -LM`P@P004pPP d0T04@0 T0L0}P0 \YP`  MЍ -LM@P 0@0B -LMP@Up U]-0S R*0P.S 0 0 05 00 .S0S00P 00 0  8*P/* m)*`P0U0  U.vP  0!0 000 0m 00 0 0  *P* m) -LMPp`Y@P 400PP<4p8`@ -MLM2BK0J@,0 PJ `p 0 Shꨳ ̳ L Դ ]<00S0D00@Rt1 < Bp 06 P0 0 0 48 2P@ 0)0 00Sp.0+@P/ @0S) 0S&$] 00D0 0 0S00< S00<000 0D0s00   00(p$-0 0p ` ,0 S ((K`% -LM@`pP 0E@MЍ/ --L]Mp0P@C/ 0 KKM?K`1 `4Q 0Q (l0 K A A )L0 Kl1 | LQ 8 0R d(K x% -LM<`00P,0 pKA8 < 4 p 1S01 R rP t 0000 0C 0SP q \000%R@QgQP'eQG*GQEQC*9Q0Qk*%QA *QP Q7 AQ6 DQd[Qv OQg XQl LQBcQLP aQ!pQ jQ3 hQ4 iQKnQ MlQ1tQ6 qQ1 sQ xQF zQ. uQ?PP0SP 0S0 0C sK@@0hS@@0lS@@L@@ 000C@P  P4# z@KP0pKp"KP4 n0^S  0K_C0 S RJ!- KK0P-S ]S S@Q00]Q0SK_K0 RLP9"K @P3 0p0p@  0p p @p p 0Oq (000 @P 043 P 4 0SP  00CS000P r |000U񟗱8 ļ X  PT*00PP'd 0hP Q 0bP 8p8 X P0P CU00  RP U.( K001SSU$@P0X0C000  0SnP Tj (K001SSPTe 8#p 8# BX @ 0@ B0T0  REP 0 r 8U000 !P@ 0C00X0  0S'P 0 r 000 8 0d p8 T0HˏKS:fRxR:4PI4 J"40043 J400S43 43 S  :J   60K0UI4 0 0CS0000PU  ?K0CUUڱUXPxPPEұ;-0 <4#<<4#Y   0p@  0p 0p @pp8# 8# < 0`X H?K<RPPJ,0 9R 0RJ#*-R .R +R!ER eR  J  J9S:J0 0CS0000:PX   _K@PEt[T-xePEP RxO;0 <e0p@ <e0p< 70p8# 8# KcKL ' 0C7 7-K B' 0CL@'7 7  A B0C LpG  ' 7 @ hG TG  m@GF_K46 @%S@D  0BPZ@T `TJp'10bVB\&X6 R0X6 \& |+PjKp70p7 Z ]K0@PE<7 @G t7 l -6K.6K@@ tt t'  D6S1'*t7@ D6S1 8CX0 8CXtD  P 1 K0C` ?00 0fT P@s>K0C0 F2K F00LQ : d4 KE\e\0020K000 l40K cP`' Pt0P7 - P l7PPPSt l0P\ P' t7  D6S!VW(D '&&& &%%&,&%4&l0\0t-t7@ D6S1  K0\pt  D6S10p  pt7  D6S10  pp}t  D6S10p  pot7D  P !  pp 0O]P10p  pStt t' t7  D6S1 `@` p<tt t  D6S1%(t'@ D6S 1 8#X` 0 8#X`t7D  PQ`P`   P 1 P`0 P`p D&0R10  P`px0 H .6KDP㈁0D D7 D  pPH3sNK@D `#@70tD @l'RD+pDP0PP7 -6Kt70t7 t t  D6S1 `@` p<tt' t7  D6S1%(t@ D6S 1 8#X` 0 8#X`t D PQ`P`   P 1 P`0 P`p WH t' t7  D6S1 `@` p<tt t  D6S1%(t'@ D6S 1 8#X` 0 8#X`t7D  PQ`P`   P 1 P`0 P`pt 0 .K 0-6KllQt70ãt7 00P04K! R 4K2D 5 :R4 &l7PD' P7 N4@K"1 D>A0  aP`D t7, 0R* 000aD & 00 0d٥P`V U00DD 0D4KD H%2 > D&BP l0`D D40KP`dUlP Z 0 K☠K-6KP7 D' P-6[Pt\S.6[L L SLL x ,<'L7@cTd`$H\&X6 R0X6 \& |PjK@DT 0@\&X6 0RX6 \& |P{jK-6[S b>K0C0C000\& X6R0X6 \& |PcjK.6[S b>K0C0C0 /&K000\&X6 R0X6 \& |PIjKx\,<L@aT`$H\&X6 R0X6 \& |xP.jK@DT 0@\&X6 0RX6 \& |cPjKP'@eT㘪`$H\&X6 R0X6 \& |LPjK@DT 0@\&X6 0RX6 \& |7PjKt7 DP\&X6 0hP,9h dQ<6S\ʘ;000\& X6R0X6 \& | PjKl'Rt7 00h\& X6R0X6 \& |PjK<6@cTTlP$(\&X6 R0X6 \& |PjK@DT0`@\&X6 0RX6 \& |P~jKl<6l a@6D\G0aT@T\&X6 R0X6 \& |PajK\'?@cT|mP$(\&X6 R0X6 \& |PIjK@DT0`@\&X6 0RX6 \& |~P4jKDl7\SD t 00h' \& X6R0X6 \& |aPjK@6DlG0lT@T@\&X6 R0X6 \& |HPjKl?@cToPʡ(\&X6 R0X6 \& |0PjK@DT0`@\&X6 0RX6 \& ҂{lQt'U Dh00K00K0K000\&X6 R0X6 \& P|Pj^KDX'0B0\&X6 0RX6 \& P|Pj^Kl7X@iT `2H\&X6 R0X6 \& P|Pj^K@DT 0@\&X6 0RX6 \& P D00\& X6R0X6 \& P|Pgj^K40K0`\&X6 R0X6 \& |PTjKt* <'L7@cTaP"(\&X6 R0X6 \& |P9jK@DT0`@\&X6 0RX6 \& |oP%L'<p1 R 0lR"X6Sp  |\P0jK\6 X6S eKAA|NP0\6 p |0@ p' W000p7 TwW uMDP m>K0C0CP Hs6( ,0 pS _(K\0l0% -LMHp 0`S@P 3/ 0@S 3/DDQM R P000SЍ/M0Ѝ -LMhh1P0S XX18P020SX000S001S q@`@  \ J\0 \ @:`p@P0VV 0 `00h@0S \\0<0S H0@@ X 0 0t<LDDD|UUQ -MLM, PPc 00z10GBNKa@D@D 0P<KHH  p3 T0S \<PT> nK`F`F XpFq(K0!MK0@D@ @D0<00( K\ T  (0!"( @8S 00@( KpPs<8 P@D8X0P ,0 S I(K P& p-LM@ pP  ɛp` ˺0$S Ǻ@úP@p p-LM`P@U`P`0h`  h0S0#*P0h``0p -LAM MA}K1 pGJK0P pG @D`d <@DAK$0 H.0SI\1 K 3RC0S@0p= ; 9 BnK0 `FD0H  0S-"[<0R)"[80R%@LP 0  XW000 jK0 `F@0`F4 @DTA=K 0CP d0R :00 $0 S  Kh& -L4MP`\K@K 0 Sj0 H 8 @  0P0S=0 PX0QL00L0P SPLT01QGPC<0 0X0 S  0L 1Xp TX 0)pp2Թ@й@p ppƹ@¹@p0`h 7pḹ@봹0w@0 dp p0 S 0WS00 0 0s 0L 1Xp 0l0lP@@ X0.K8#8 $`#$0@"K@0 < TX0( K0`0  0P0 T +-p@c0Sl X0 0Rl  0 00l 00C@al0S'p cpD l00Sl07#!dsp4 0K@0  |p&0S&P l0`d 0Cpc@ Sp0SP 600 l d0 0Rl j_p @0@00SZ 0 S00RL 0,1X d0(0`0$0` D0 0 0A R  0  $0( H0S  H0000DP* P0 P000-0 00000h S?0000 00000000 0 0p(K -LM@`p(P 0@] -BMLM10$0 `pPP* 0 0MK@D*00  X`\`TBnKCKA `F<4S N00|0 K032[<02[80>P@ %P $0 S  K x&0( <0MR0(0Ѝ/ -LM`@P$pK$ 0S@PU{PKd3 -LMp`P0K ᐳ@P 0 0P*0S S0@00  @00,ͱ P (K& -LM0StpPB`. T@! 0PU`pPE@TU E000 ,Q -LMpG P =00D00 H00L00P00T00 X0 MЍ 0-LM@PP & P 0000000 000 -LMPQ`p@P qP) 00S.S%iP 00S.S 0.S PeP*L 3P * - TP*hE,Q -LMp P \@TP@@  T`h`P@ PM 00CS0ЍЍ/ -PLM@H0L\@ 88 0K0C@ TZlP,Z00Z0S@ LUKLQ[P VP?@ TP@ UKA`IPD@P T1 @ (,:P#UnK`FP@ 0P000  IP 0 `0 垎05SP` U0S,[P@A AP\( ,0 S L(K&&&' '4'',G'ȼ '& p- 1LM0@0 <0SP0S 0S _K~P.PV 0S P` Z.P P .S 0SR U 0 S Kp('<'& p-MLM10`0 P0:0/PP JK@D@D*#** P*?PP JK@D@D*p *H* P*' 0 S IKpT'`'h.l'x'& -AMLh        0 p TP 00 `P @@P <8P 0P P v/0P 4P |P `P hMЍ p-LMP@ἳ`P@뱳`p -L(MP 姳70 S00p4 3K@KPP 4K,p$0LKS PPD8 LPK`@0KPU`PZ k 0P` /2`cpWF$PP g (K@B0M 0Ѝ/0M 0Ѝ/ -QLMH L0  Qz L<̠Č8#Č"̌,,H0 @,̠H!sd 0 0 @ P ` p D0  @ 0<0  8 040 .2 0$20%20&2 0'2(0(200*280)2@0D0#2H0@0@#2P0<0P#2X080`#2`040p#2h0"2p000 #2x00 , Dl  D@0  L<  T8 \4   t HL4 d @P`$p,4< (K'' -2L$M0QP$0 p` Q QiPc  a8 KD&PZ@ O800@PP%P ᘬ@PF  f004 K'&P q:m4 K&P0@ % 40K@ X 40[S30[0SS 30[0S SP @0S-!@ T @!  < < d0 X10000 40`VZY`w 0S0%500 r<040R(0 0ZY (KH(X( -LMkP"{`@pzw`&Kp 0Sm"[0hS153 05f:Q Q Q QD1Q Q6 Q=  O8!Z;  !P! K%! 00S   0S   [d0 $000 0S 0"[0hS00 0 0S K<( p( 0-LMP4 @ P0 -LM0@.SP#P*QR00)P00X0`dS F>R`V@1@! WP P0@0S.pJU000U -h3LM00< 00 0s 00 S P R P u@0+S  -S00  ` Pp8 4 !R ZZZ Z5I$@ `Vޯ"0I845A$@  8 4  0L.\  0 S00S@ P 8 0O4S "8S8P 4` ` 4` \<@8 K  V d1d0@0\ 0 R \Ap 0P0 00<11 0~@PzJ U  0TF9#ZP e@P X 04087# <0 @TU00 (K1 18 @0 0<0 0040 V 0K! 0'0`0 K1' 00cp PT00S d@K[ K ㆞p 0#4 Kp)0)*** * -LM@0pS/P00?x`-5P@"2L-,P?T00S@ 0S "  -LM/@0 P0 K?pK0P -LMP\@pT` U 8''V `/ר(@  * p-LM(\$ 1 0S 00CS00@Ӥ0D@`P0S 00CS00Ӥ0D PpNT nT tph00S\`00CS`0X BaX0  X0 !a 0*ED@E p-P1L$MQ8K< @,1@TE ( (0$KS 1 (0 ( 0p7 $000 b0p P $5*<0S "bcU k8KzZ$&P `K vp@ 0S T 400 ( 4Kph)5505 -MLM@``K, Ph P*K0P`0 0[:KPd` [`P zK(pG4pGK:K(Hl*K(0Hp0w2 P DP*K`` Z:7@P:Kd`_ ~U*Kh 2P :00BPH kU> :00 Pb :K\PV 0RR 0RN PI 0REKl0 R?( (0R;:Kp0 ,0R5P0 P+$$P&*Khzp$ :Kd PZ*Khjp 00S0@ 6|PᓲP :K`ht_ KK`+ᅡ ,0 S ,(K(@@|%T*h*D|*`) 0-LM(PK0A(0 $@ 0 @   @0(0 $@ 0 @ BBB BB4PB$B0SK0? * p-LM\`@PSPp D0T ڟ,PPp @@p00 -LM@ L Np XXXTat -0LMM0,0 PPWoKJ%T1[S   (@P UK:,MK6 wh0 l Z.Pp p ,0 S (K** -LAM0 , 4$ 84 `eȑ@ PZ?0005ApP 07P H0S hh!0B48$PD 90S@ 80B^KPE@DPE (0K@tD|fP?p%0 %@P P 0+4J Plpp 004$84gPe ,0 S 0P(K***** +,Q$a* -LM< @ Pf p0`KV8 D0 Sp PQ 8 n80@p# Pp0S> 0 `PP8  ?P@ `@P7 00S4 KrP 4 R ;;S _@P!0 友<P 4h _Q@  0 8K@PV ᰟ$@(K*@x < +x,&RMA Q:0S Ѝ/ -LŸMS 04 < `0 80 @ D Y00K00@ԟPPU 004SQ@04 S  P<0eS\00 @000T:0 R 00S S0B00 08 QR 0E 80R P000C00 0<pqp3\pW  D@P<<@ Q 0 00<@  pX00V00S< < R9 6P4 0<pP@"0B 0S S 0S 4S8  S4 S S 8S S R`00 0S 00<D R<(K2+ -aMLM20$0 pP" p` ]KPE[NK@D !+z 0K 0(E 5 U\e 'LpT[cKzPXGl06: S  S [NK@D+_S K@@MP[NK@Dx1t!x@ 0K@@XH:AUTUaD[NK@D9`P%0S & K0UC+`PX& #"n/KKPX [KA# K2SPX [KlA\`00S $0 S 4I K)wd ++ edA++D+8+ -LM  K K0K P K 0-LM@PPP0.S 0a C00C0  SRQ00 -LM  K K0K ֢P K -0LM0`p  $0 PPKPUOK W SKW,KKWJQe.9P _K5Q $0 S  K,, -,"L$Ÿ M RP`@ 0 0 Q 10m Q 0 0P`bN Aʠ^   0b< 0BcA4H6&? `? 0S_ c`\ Q @ p^00P00S P@T00Q n B2`p? W P  |0 ` 0:5 6!ƠP ` -LMP`pDPDPk@kT kP  0PpP` -QLM@< P@0 R0 0P8 < euꕘ$*`@ 2/P@&@03/P  0Q0p <净XJZ p< e║!0 4 4 080 R4  0 R0<`A< ꕗ$*@ 2/Pp@! 0 R0`<0pWV㕖' `ᕖ$8@ 2/P 800 R  0 R04 <00Q 4 8 (Kk*C-@M 804 (, $   [ 0 "6(Ƀ.,40(0P` 0P`000#(p@$p'P(`0 @pP` P`  0  $08@7(ǂ P`@P0 `00#@$ "!0 @ `  0800Cs80@Ѝ -LM `00#@$0@P|0#@$G-|0|@p!"h0h@P'`(`0`@! "X0X@0#@$0@M0P ` (0 0$0Ѝuespemosmodnarodarenegylsetybdet -LM(0P0 @` c(0'00@0#@$0@/`0#0# @$,@$`&p' -LM@  -LMPUp (0`0(0 @hU 01:  j`Pd cPE` @U U  m -L4MlP@K`pP$ X0  w$ 0R  K, -LMh0`p@P@T00 0S  Tp @0S DD* --LM0 0 KG-$1M0 ` p00S0 XSxS  R!! \s  D A0a00c0PP@S @0 C .S^ s 0 0m C Q171Q Ѝ;?C0C,  4K2 74 0 0#2>;3Sa SC S- Sy'S- St4So S Sj Sj:SL Sb Sa^S\ S\: SW "SVH&S SQ 0 P!P1WWIXF4!W,1W? W< W8>32 0 00 0->400 2&0aPC E 00>  >3 0>3 S0 >01 >3 S00P@ UsЍ -LM` 8 Q0@4  0Q0 pT|0 0Aό  P=0Z W00 W00LR,@P@ X00  X 00"U00P@T  T 0  @Dʰ1U  WD w 00 000s03_W0S  X xd 0  0 _X00R08!SP W" w 0  0 _W00R0S U  X x 00  000s03_X0S PA?E0CS 0  0<04 80 Z\0 04  p\0(K#R R R >3>3>3 SR8  R R R R RR RWp0 0@0  000 DPP`I 0`P 0 `pw0 0`0  000 FP@IpP 0P  P00S0@P R@ 0rpE0 00  000 JP0 E0`0>3@ 0` 1>3@1>3"S@D0 @w PP0 @<p 0 >0c"O 0 >0c"O0 @ P U/(KG- M,0@H`pIP>3Sg SD S. S'S. S5S S S} S=SW Su SvqSo Sq@ Sj "SkV&S Sf0X !1XX]YZX!XSXP XL>32 00 C 0 > 0>0 0 `0 S004S0``C/ 0>0 0 0 00$ P >3 0>3 S 000 0>0 0 01>3 S 0     0 0 0` V] Ѝ -LM8  0p 1>#R# R/ RR7 R R R&R; RV ~8WY 0RU8 WQ 8WL >32 0 0C pc0W0] 0W80W5*0W0W0O ,+*0 S(0G$0W!* r 0_R0W05 0W Wr 0 _R*0W0 * R0r 0_R 0W Wr 0 _R  !>3 !>3 S .Z00SZR 8W 0J000 Q>3S9 SF SM SS Sd S0>S4P "0st `@S dR 8 0dW  P040 !0S   8  0P>3 $0 1p 1WA  >3 q 0c 8 P\ @>30 @C1>3@1 >3"S@D0 8 @P<0 1>3 S5 @>3@d_8 0 0 P0 0 @>3@d_8 `@ P 0 |P0 0` p(K#R# R/ RR7 R R R&R; RV ~8WY 0RU8 WQ 8WL >32 0 0C pc0W0] 0W80W5*0W0W0O ,+*0 S(0G$0W!* r 0_R0W05 0W Wr 0 _R*0W0 * R0r 0_R 0W Wr 0 _R  !>3 !>3 S .Z00SZR 8W 0J000 Q>3S9 SF SM SS Sd S0>S4P "0st `@S dR 8 0dW  P040 !0S   8  0P>3 $0 1p 1WA  >3 q 0c 8 P\ @>30 @C1>3@1 >3"S@D0 8 @P<0 1>3 S5 @>3@d_8 0 0 P0 0 @>3@d_8 `@ P 0 |P0 0` p(K#R R R >3>3>3 SR8  R R R R RR RWp0 0@0  000 DPP`I 0`P 0 `pw0 0`0  000 FP@IpP 0P  P00S0@P R@ 0rpE0 00  0|00 JP0 E0`0>3@ 0` 1>3@1>3"S@D0 @` PP0 @<p 0 >0c"O 0 >0c"O0 @ P U/(K -L|Mp 0 \  ?R(00  p S$0 0    0 Y:<`V Ph@ 0R0@ UKP @PE Tʠp0 ` Xp 40 d \0 H0 T P @0 <0 80 X0X T0X`0 `Xl0AϠd  0h t P0tXph|\ Vh d00 V`0d0],@P@ Wd00  W `0<U, d0P00@T d vT 0  @D| U  VD vp 00 000s03_V0S  W w0, 0  0 _W00R0SP V" v  0  0 _V00R0S U  W w+00  000s03_W0S l[A?E0CS 0d   <>  X00S  0td   `ZhRL  x\HPH0S dPKL 0@PL00L0  ^H0Sf \Pd0 D \ \0S!  \02  d0D0RH0S `0 dKL 0*LQHP H L0SH0S\ dKL 0,P`dPKL D T 0 5/@P 0 - L``PP" XL0`0`O/\ @P` d0D0T\02P`P`@T\H     0    ^*<`V @Pi 0R0@ UᗽP @PE Tp@ d ` Xp \@ H@ T P  BP@ X d0D0 < 0 0D 80 0 0D 40 0 0D0 0  FX04Y80<@x0 |  T0Y`0 pY|d0 000AϠ0 d@"d0 x"l P0d`Yx 4lP  Wl 0 W`0,@UP@ Z0  Z `0XXşX%U00 P@T d T0 @DU  WD w 00 000s03_W0S  Z z$ 0  0ğ _Z00R0S P W" wp 0  0 _W00R0S 4U  Z z  00 000s03_Z0S SA?E0CS0d  0 Y00R0Sd0 |d0 xzd |0m pNlL 0S y\H@Q H0S dKL 0@PL00L0  ^H0Sj \Pd0 D\ \0S0  \02  d0D0RH0S `0 dKL 0!LQHP H L0SH0S\A@? _dKL 0PPL D T0dK F@P0 dK> LPPPP" XL0`0`O/\ @P` d0D0T\02P`P`@T\H@ L0 SL0S(KeE 0_X0,  0  -0.4 0xB^ 0244#  0=> 0h^0 p-LM8A0S,1P0S 3/PB PP?>@:00S 0(0S 3/00@T0`P0S 3/PP  PP @@0S 3/@T@ 0S 3/@T$00S 0,pdFDDD MЍE 0-LM 0@PP \0P0p0 $0姣P00C -LM 0P`Pp h0勣P X0U@# <0O 0pC=M&"R!" Q\R0"S0Q0 #Rt0 00 R R R L0 000 S S S  R00LЍ/@ -LM$@P 00D -LM0@P ՋHPDdJ`, -LMC0SP S gP  sP0t00CS00 Ӥ0,g R r  r 0R#R S3 l0@S0 e0@S0]@2b P  _P  r 000 00T OP  r 000 00 0] =P  r 000 00 -P  r 000 00 P  r 000 00\ P  r 000 00  P  r 000 0 0 P =Q P@pWyx00#S #W0 S SHP@0 S0P0  0 DPP1P 1@ RY0cr1WT @ %:TXZ I0SF H 0SB'$0 p`p@ .T5`,0KV1 hP,@TX  ,0KR!0'$ p`Z<K 0Vj  0\0 l^A0VD<K ׋/00 ,0 S /(K--- -LMh0`p@P@T00 0S  TP @0S NjDD*- 0-Y+ ̌!0M0@  0Ѝ -R00LM?@ D $R DP@x0 < 80 00P2@p0 @t 0-T0@40  +T@4 4  z 3Z00S 0T0XSxS@p R 0T  Po 0r 0r0 < 8 00D S t8 @0002 W070c P,R(8  R<0S <@0T8 \00P00S 0< 80 "0 0 <0<@8<# 0O<0 8@  @40R00S <Kp< 8 DQ RpG@p @0D 0<K(Kp ;$U eXW 0Q )K V U PUo0 ONK@D@DV  U 2pP@ W@lKT ,0 S C(K- 0-@ MPL 00K0 -LM@P4̻ Ļ Ļ Ļ ػ ػ ػ Ļ Ļ Ļ Ļ Ļ Ļ ػ Ļ Ļ Ļ ػ ػ ػ Ļ Ļ Ļ Ļ Ļ Ļ ػ  ػ d R0 0D<4 ꓉0 0 4... -QLM ,0 (@ 0 0 @ 0$0 0 ,KKLl*Q --LM0  0 j KE -PLM `h1U00 0-PPLM @P F0@@T0>0000X 02 MЍ/mNA900 M Ѝ/x 000MЍ/xL1 -@0LM0S2  0 :900xL1mNA -LM`ppPP`0 T p 0@Tp00` -L M0  K* -L M@0 0Q(0 0$0 00K 0 00@  0 ,  l1/h0 R r 1S01< KY|(0@0S 3/T KDDh.E@E|**=$*@-AM@0gS -S0 XS1 +S50oS uS0=#80  0 30100  0301000T 0ЍI@@-gQM@  =Q +Q -QXQ1 oQ uQ, 0R0- 0+\ 00\00  00  00000+T00 -T00 =T000Ѝ -L(M@T l8@K04K 40 n`n P 00 00C S`L  <` P`@ * 0K |00`0S>0S  "00hL0U@1:  ?@PP <0p%=f0 0Qp0gS aSoS uS ~p'}C~pp+Y -Y=Y i녇 0D0=Y0D0 H | 0sS gS# XSoS rSuS :wS xSyIW  W 0 |ꒀIX L U:@  @  ̓@P 0f0P@0 D!L `<0  PH +Y00R0D=YSD  L U:@00 @0 夃@Pc @0f D0!PL `< H0X PH L0U:@  @ 冃@PE 0f0P@0 D!L `< 0PKXD =YRLD0=Y0 UD0 :@  @  _@P 0f0P@0 D!L `< 0 PH R$ L0U:@  @ @@P [0f0P@0 D!L `<H0X ]PI H !0S ,SpX+-0S2 `0+S -SXS@0-S0 @ +S0 @XS0 0`T@p\p^p (K -R00LM?`p$RW?00`1P0 @t 0-T@ +T@ v 3V00S 0T0XSxS@`P R 0T ``%0  00D S t 000 W070 cRQ00\00 R00S,, "  @Q00 SlW QE (KTP0/ -Q00P00LMS 0S1ó0 K K -LMp@CP< KGPP70j V_WO| p 0P@P 0D` @0 D0K<0 080 <K04 K PP0 0GR-44SE@PGK%)0SS`D 0DP1: S 1R D 0GR"  FPPD(K. 0-h0LML@\T PHA/0 JQ QF& Q*  Q Q>*0\  n00\  r00m0\  b00\  a00\  v00\  t00\  f00\  s0\00 L0 R00000Ε< P   ?Q*Q #Q[Q \0010"#0 000 0@\00M00| `0000  0^  Q?0@00-  00Ѝ3 01Ѝ/ p-LM0@S`p  {PP p` Pp p-LM0@S`Pp 0S0?0 Pp  0 1 p -LM` R*P*0S0]SY\pPhLP0Sp@T U @1 0-LM @R:3 R!*0S*0[S.Q00 PR *0S*0.S0]S00 0 0 -LM@ 0SP*( P &  P ^000 `0 00Vp(@@ zP> 0A0 zP00Q0 1#"0"Q00g 0Q P V001"LBA2A` B,0V 000 0@0@00 @o R*0^S00 R*0]S 00 ]00]00]0 -S00 -00-00-00-S [SR: }0:S =Sy 0S0:K00-S]SC R*q Ɵ000vj(P0S p@ T !/ 000000Pp @P@ O @  @  grf00S R: R*0S*0:S0]S1 ` 0S0:00-S]S=T 0000 R: R *0S*0=S0]S00/e pR*0-SQ*0]S -P00W@ @ 0000000SQ*0]S  R *-S 0]S   -00-00-00 R*0]S  V0Sb 0 0h@Cp0 t 000 !P 000000@DT Y 00C  0N@@000`00^00  00 00 0C0p 0 0P\ 0 0PWo 0@0S00T0S 0 0 00Q\ \ @T:`0  bB"o(w$..{} - LM@0 8 V ?U pf +U*Ua*$UN (U.U]^U8 [Ue \Ue{Ux |UIR:0D  D 0DP U 1  Q R*0)S ) U 1H  @ R*0)S V   2 (00(0 ,00,0F $ (00(0 000008 000P )  $ R:0<Q0 >Q&  R*000C S t R*P*0E0?US{U0S*000C S0Q0  V+U *U?U' {UzB 0  g  g   g0  g    g0  gT 0  g  g  gc " B aZ   `R*0,S00000C S\ VP P 0 R*0}S00  R*0}S  Q* *0B0?RS{R 0S*000C S 0S*P|U 8 U0 S R/*0|S,00 0R    j 0O 4 0   i04 aC0" 40 o4  a  i (Ko0 R (K -0LxMS` 倀2  PPa *+P@P ' 00 0 EtP   0K0 @ `   P(0 PHPP0|P40 pPP P(P,P0P3S S SS S SP`B B>3!>3S S "S (00(0@0P@P >3S@P P<@@  >3S BR000S   0>3S SPASQ(00(0l0L0D 0 T0 @0(0 K=0S  n(KEe -LM X0R @T @0R000gec<ah^eE -RL MP` ?R0Spg1 0S 3/e00P @0P <0 000 R r0 11@ppp *NZ@ ,K0 KtV@,` X?Pp,0Vp `5pX@ 000C 00 0 |00S,0VKZ@0@`0  f00 `00S 3/$KDDX -PLM 0@ 0 @ K0,K0 P0@,0 (@ ,K -LMX0`p@P@T00 0ST @0S uDD[* --LM0 0 -L0LM@`P8 4&iT  尹 .v QE< p-LM@0`@PT00Tp@ 0Sp uDD_*3}* -L,M@P 0S (Ko8R000 r$P0-0-S*000 P ` p  0 @ 0t@ P`p P0 0S 0S Y0Y 00(K3 -LM@ T00 -(LM"x H!X` P $ h HU -LM0K@30S 282 2R ,0 S 00S20X` 2 " 8902  (08`"#Hh208#X@ @2@@z8r X`v@ T  Xg!A 0S11 " P "<K<K00@ @ S900,1<1(Q41 0@ 1.10! @B0 ^ H <P 30A3200 Q#P D80 x0RP $$0<@ KDDD4/uy444 -L8M \$ p`<@ 勿P @ PU@V@K 02R R @ RV@K 2 h 27WP   $0 S L K45h2 (44* -LM@000@00 0 R10K' -LlM Q 0 000?/0 S @?P046S d  X  0㌀ 刐 P0  H \K4 K00KPT R ):**R K46oB`FX 4 000C Q@0a3 A 0a8CnA`FAX h>ߵd.d>#`.`>@P.L.L> 0@Pỷl 0㌋P l 0PlAl l R0h0 l=K1 sPlࠣA h l h 00l0fS0SaBC` U|0 U| E` E^` ` \ x |0l0ll|0 x \  R @R0@0C0 Ő@\ t p d # d 0  `t  p d 0d0 \ ` t p d l 0`V0Ft` p0 `t` 6PH  t\00S2 l^+; NB1`p;K _@@ fP`tT p  0F"l @bT ; 1 KHDbP@p` <@PV ph0S :  㪊tP00\00S@ P p^  P:lp A< 8 t0l80 <  0 :ʹ8`^ p@ UA 9 ᮴ 0p`tP8 L p 1gPd8Qd)1A 0 dǴ 0ᎴHD w@ݰ 00@ 0@`P@DPD  0< l l 01P 8 D8\S p8垵`p0 0ᖵ  H9@៰ 0A 0`P%8P 8 80@ Z 7@ 7K< 0Plʄ K  0P 0x0S <l PU`pꌀK4 l0?Q0Sl t R00Ӭ61 R 67 0cPlpL < @H P 0̵2 0 0ѳ000 0@PP ,6 t Y' 0г 0@P჈P<l  0P HXl 00 l 00x9S 000޴@Pd0S|PL0  X\00CN@6@cPL  `|` P| `0RS``0|` S 0c` Pc `cxQd R L0PL0  TK@P TT@ TxҋPT  ㏋pP \\ ƋpP d@^00S X 46S 40 S `P` \ R0 01| 0`` 00 0cS0C` S`0` P`UTPT _ `QḊpPX h R TlPT  DPT I T L  ;PL @ l0p0Cl0 t t^&ʐQQ" (pP. t R TBPl0<0 L pHl P H100<00l0 T VLhPL  ZLLH@ P L L 偉@P L0  ! KPTPTL`@P 0SPTP70@ \ U00S Y9T* V1@ V00S YT0S0SUT PT ĈP @:T @U9T0{900t'P,\,h2?aCoc?`(?yPD?@dc?$@@@?@ t0@RC T  sPT x PL\  hPL m P P  _PP d L  XPL ] @@ nHPTa0@T@T0  \0SP ,t UP9PT > P T喉PT 5 MP  H X100l00l0 0x9S 000x0S {L\ P^ ^ rLpTn 0lS00 H H(K -LMop3 -LM@ 0 S@B !0 0@0  8 %P< @0 4 / pP`0< R0@ 0@s 80Q PP`0 @p ! 00S0  I40 BR0S @ ṇP5<p4< 0 0P0 ` 0@0s@8 00Q @S0 p ! 00S0  I40 BR0S <(K 02@M Ѝ - LM@@ 0SևP@ 0-LM@PP 0  0S0U 0 -R00L MH /@ D H$P D@Q@  Zn0<0 8@ 00 3@0 pw 0-W@p4@  +Wp4 4 H q 3Q00S 0W0XSxSp H  R 0W 00H0 4@HTQQ ȟ@@ 0OH0   0 P4`P 0QH 0@Pb`0 000c00 < 8 00G S w^ 000X W070cH0PQRM4@T! 8 V<U < 0R8@T00 P00S m! <0<@8<# 0QO%8@T<\ <0Q8 R00@P00S m!< 8 "0 0 <0<@8<# 0O<0 8@  pD@T RJ@ @D<K(K ,K njP6,0 R% 0SMR GR KR R kR mR gR`PA`VK $` @ `[F`Q@Pڌ# Tp#LX`0XX `P0P00(@$K6p6R 7(7H7 -L M`Q0 8@ 4P `< @0 p8KApPP  P!0,S@P  00K hC00S<  @0 mj0 0Wfj00 (Kh7p7 -0LM0 Q0  0S0S $S02SP  K0=j 00 0 S KX7p@-PM@0#!P0 "0'0%"*0V#" 0 !0'0%" *0##?0 0 0Q` :Ѝp8 -BML,M0ğ@,PK,@ TK @<T0$S0@2SaY bY0*K0HPH#K 0$S00@ S 00B S0$S B 0##0J0S0ʠ*K0?S<0KsK@ 'K` @300S  P 0 1"2*K DQ0D* |PUy 0< 2"10DK0#Tp 0h @R`c 030DKT`  @*K T05K@TpKV`KpPK @TB]K(PEPE@p`K@ l@TTKpP `0# #$# 0PUK 0 !f:K0<@K K B K(@@ i00BMK(@D@D^KPK`p  @P 0 @P 0 S K7 -0LM0K0  K0K0  c0`x0zp 00PS?@0< PS 0 S K8@B`7 p-0LDMY`K =0P +P+@(T @P h 00= 0 S kKp7:G-0PP%%8%L01%@4a0@,@$ @$$8$Ġ$ 0 q1ß` 00#0 P%P%%8%Ġ% 0 q1ß` 00#0 @$@$$8$Ġ$ 0 q1xß` 00#0 P%P%%8%Ġ% 0 q18ß` 00#0 @$@$$8$Ġ$ 0 q1Ÿ` 00#0 P%P%%8%Ġ% 0 q1Ÿ` 00#0 @$@$$8$Ġ$ 0 q1xŸ` 00#0 P%P%%8%Ġ% 0 q18Ÿ` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$8$Ġ$ 0 q1x` 00#0 P%P%%8%Ġ% 0 q18` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$80$l$Ġa0 qA=00. P%P%@$M@PЍ  $(,048<|4G-0PP%%8%L0%1aA=0@,@$ @$$8$Ġ$ 0 q1ß` 00#0 P%P%%8%Ġ% 0 q1ß` 00#0 @$@$$8$Ġ$ 0 q1xß` 00#0 P%P%%8%Ġ% 0 q18ß` 00#0 @$@$$8$Ġ$ 0 q1Ÿ` 00#0 P%P%%8%Ġ% 0 q1Ÿ` 00#0 @$@$$8$Ġ$ 0 q1xŸ` 00#0 P%P%%8%Ġ% 0 q18Ÿ` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$8$Ġ$ 0 q1x` 00#0 P%P%%8%Ġ% 0 q18` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$80$l0$Ġa t0 q:0. P%P%@$M@PЍD<840,($   -LM G8H0@-@MP!\#0  0(^D"ȠЍ0 -(LMZ0p"2K@`.K 0 8#h "V 0AM80 2K40 @4`K8K W8 40 0PU   K4 0 8#H80 T0P`V  `U @(K -LM(j<0 0" x2K@P. K<0 8#X "U 0A]80 2K40 .pKP  4@w 0  40 8@p8 K0 4K80 8 40 0`V . K 4@] 0 . K 40 8@V8 K0 4K80 4 0 8#h80 V0PpW pU`(K -(LMp"h@P08#XU @ -(LMp"h@P08#XU @ -L Mp#0@P`8 Ƞ<̌@04Č00 4 004 ###Ġ""H"T0@P p0h S 0K4 K:(K -L Mp#0@P`8 Ƞ<̌@04Č00 4 004 ###Ġ""H"T0@P p0h S 0K4 K:(K -L Mp`4K/0 0#0P0 8 Ƞ<̌ 04Č 0K 00 4 4 0P-[B["%4""Ġ@0P `0gS:(K - LM@BPC0K4K8 -8<0 400 0 8< 04 40 -0[02[ 000#4 000 010[ 03[ 040#404000 0#0Q@DPEUp  `<8 400 0 8< 04  40 -0[02[ 000#4 000 010[ 03[ 040#4040080 0#0Q(K p-LM`H  P3$H ph8HWy*@-@M0 0#@\LTЍ 0-LMP@ $K E0R$@ 0 0 Yc004003200 $K0 KP0K0TW - PLM=c0 0Q 0S0K010   K8*9*H0M0S 00CS0Ѝ;;Ѝ00Ѝ/D 0-d0LM 0@S 3/00CS00PӤ0;P00S 3/0DD0M0CS 0Ѝ ;00Ѝ/MЍ -LM@>T`p@P  @00#:k0cS:UV@ 0ဦ`p -LpMoP0p U<0  yP⫶P@  P>0@H0 D@ 8p 8 0 S S*S? +S -S S x 0x0 080 0S,080 @x@ 8 00S| 00XS xS!x@<0K8K@ K@Zv0S@ Ss SV x < R =PKhx<t{0HKPK@ QC8 080 00S S; | 8 T  t Qt@Ւ4$t@ 00@Q:*080 8/P00@9P0P M0SI RQ 080   @@ 68 @080 0P 10@S 28 T @0P@ 0 PPt0t R  \BSt  0ӓ"t R 0ӓ*@8 080 00@ S00 ᄐ @EPeP:|0 y 8p 8 0+S -S```080 00@ S8 080 0P 10@S8P0@ <,808 /P00@9Pڨ*0e\S 00V0c08p 0XC| R9NP IP4iP nP/8@K$|wP( 800C 80 twP80080 H:D0 08@KhwP 800(S P KxPL046D0 P0H0 L0H0 D0 H0x0 8p DX``Q0it X0 VH D 891H C @ P 0ᴣH D X,w|P)X@T T8HK؄1 PhX0\ʤHHK1 ˤX 0eA ƤH D X0s`(X@0##HK 解X0f @TW  8HK1 誤H D 0 MSl p h d (8D0 0H0 lQ <zpyhylydy꘧CbpH@K0p` 聤@PV!H@ DP D056CD0 87HK1 oH D D\'7 R6CR7 D0 560@ H0 @ D0 RO@d  6HK1 ?H D DbB V60␦j0p0 H@K0` =@PV pʈH@ DP \ Dh60#:kcQQ04QH0 A0276D0 H0 1H0 HK 0P l p h d 0@H0 D@ m `5T t0vPl Y d h l0yPp S l@  ! չHK0 K40KyP< D zPh ? X00\X `4 ࠣSc00CD0aS6b ` $ cRb0 B"00`0 ` @0` @T00 S 0S p pc@c`c^ hzPh  <@zPP <ywP t0崢A`p3$ 5N`IhI5@dc|8I?|A?55?5?P9 (0卢Z@P@QzP`p l0H`pD0p Q\ (56CHKHKD0   0f 0HK-H D D 0A0S56PD0 <$\q S\ < 00pXs80W:\ <0000D b(KM. ".Q  .RA Aa0A \.\A Aa0ARS 00A S  RS 00A-Q S _Q  QЍ/0M*S0.S S ЍЍ/-0MS]S.R00 S Q\R !R!0B.RЍЍM]R0S! CЍ/0MЍ/0 <8MЍ/ <M 0Ѝ/ <0 Ġ 8M0Ѝ/ -- LM 0  -PLM\ p` PP@sNU  00$vNf  dN[ QE<xb( M0ЍQG-HM@pP0 #2b P"3 UpG1?7 (1 L0LLLWW& 0 00000 R0 S` h.22 1 W00&#!0=00=00P U03107:ЍI -`LM@pPUq ("000L=QN ѥP| UCxyTyyT P< Vp*1 P0c104T Vf*!0 bB2 Q05:PX` PT VQ*P!0 bB1 Q05:PC`P T V<*0 0c  `PQ/ U-zzzz0000r 0  PR=R  r 0  PRTV*0SU ` 0VS+검VX7 0 pSY@0U 0@ S 1Pp0 SU0Sp#@UpPh0U W 0VS ` TPF:0Vs3(K?*!: 6-]M0P P0Ѝ/M00P  R*Ѝ/ p-LM @R 0`Qr`FvPl000SPp 0bP0U\00p -LMPq0  |   x00  x#`pHA0S P 6 0  0S 0S 0*@V`@#@ @ RP  pR 0S '0SpZ 0p =  RP  `R 0S &0S`ZZ`0 0 0l 0  R:U0 0F@0l@AP<  0 0l 㔯 001  0 0S00 c0@00`P 0 &P ᱦ0 0a0 @0A 0  01SU @V  (K -MLMğ  ` ,  P8 @T g@ 0  (0 S00:Up/0@@0BNK@D@D+P 0K@A (6P 0* 0U/S' 8: S S!BNK@D@D+P 0K@A ,hwP 8: S0 S/ 000>K(0Cp   R0B0S/S@@Q P PU0E0/S |(U@U@K0@S@H++YP  0K@@@ $PP0Sk B^KPEPE+@P`@T04/PX 0UV 0p@ ! ( = 0  d0S00Tp0/ 00 00.S0.S%@ 8T*0 S0 T:p @0zP  D8` pP (2/P 0@  Oppp ,0 S ޱ(K,Q?M -LM:K(M850,0 K0~P04 <$] 0 Z K@@8$BK^L`P L@0A@ Q p 0S /S000SP4ٲP!RBKLK (ALA B; BKLKK @(AL@A B;0P 0FV 0`SQ*0S0.K B0 B0K8$nK0`FK`FP44@d?WPu [W *W0u@!TP0S  ]0P!TpPEr!T#@ @ P[Z:0:S7`:P1 0]S.0fhs 0RR Q*0S p`V ß0l10 0᳠[Z@P0 0 ]Z 0 00-S 0]S Ÿ 00P@0]S 0l< 0` 0T"< 0 K 0@< V 0 V$2R 20pWp 2p(K0S KBKLNL N KKP(@AK@ A< 0 PTK4 0P < SH*K8<$0B P?K4Ipl - @Ҧ`P2 AP 000000P  0 00 00@QP K40 d0 ,0 S @U(K3[! 6:-]?**M -MLM0@{Sp0}S0Sy {Pq KL0dL0  R P0`0[S   0]SSSP {S` }SVギKJJ@B `FP0SK@@>0[S ,S2{S }S-   0]SSS@ `V`FV 0CQ 0:0S0 P  00 @T (K -LPMh0K`p@00< 0ph P@ Q< R9q7 r5 10aR1  K0\`2KS   0R\S0@0Q09 B0LP*0 S L000 KK  KNMЍYMЍTp 0 M00Ѝ/ 0P UDCPMЍ0Ѝ/ -QLM@ hP00 -l0LMPpT<SbN@`P @>0 2 `VDC 0-00LM@P`<SB0hDC 0-40LM@PT<S10hDC-pM p00,,0 ^0 S: R 0n 0\ B 0R2ЍDC 0-LM@P4ᶛP(000 寛P000dOHClOPCQM R P000SЍ/MЍ/ 0-PLMP@   01S S  R 0^0 PT0 0 ^  RR11:000-PM Ѝ0S1 P P10:00Ѝ -PLM QOT0 0 M QA 0SbЍ/PM 0s3Ѝ/ -LM0S O 0P ) 6;AS00?QO T00Q Q@T0Q@@ 0lA?0 B<R<00  -LM@\prO0+QpT RN \P %WPA0  P 0S 0S0 [ 0S0 X EOT00(0 P|3R`1`!0S?0\:\0l) P6;@ S:P0WP0鈶 -LMPP`&RZ 0S00S)0 R  d 0wpD pB P@ @@pT:6SR 0S00Sp@"NT00#  00S d 0Dp00 p00 P @pT X1:00 -LM`P4 80  NP00LXP=@Pp0K0QQ=  pP6 P@4 T/00SS0&Y p@  0K@t0K 0P0 T P804 q ZU1e@:0 10(K0 0h<40B.΀T<(0  MX,\`0@S/ L$ P$1!S 0 c@] P40T$bBBNK@D@D`PL$R %L 0"L0SL00 ,0 S ,v(K,QOO5xO 0M Ѝ@Q --0LM00  00  0  0S10 c]K 00 00 0  0S0 0 S 0 KO --0LM00  00  0  0S10 c]K 0000 0  0S0 00 A 0 S KO --0LM00  00  0  0S10 c]sK 0000 0  0S040 A 0 S 庨 KQO! !%v - PLM@FKP0$KGpP3 PJ`P. R $00R 2KP00#UPP 8#$0 <0$0 0J *J40@$0,0P,0$0(0 0 0PKP@ 0-LM4@ 0PS 3/0@S 3/@0DD -LMPQ`PPhp 0S 3/0 R r A0t03U0SQ0@S 3/@DDe*RM 0S0 0A R RЍ/睊*; -LM`P @0S 3pP PUP EP -LM 0PtXW 0-LMPP E00@W@@S @@0MЍXW -L M0`SPPwFP 0K4KE@P 4 R 0#S S 00S# S0B40 4 PFP0d40 4⍞PPk 4 40IP@@0 S SPP hxIpPP  I00S ?R0Sp 0S㩝P PW@Pp)+ S S@" 0@1U {FPI@hI @00000c0P@L2IP p@T 0S0 0 (KOdJd3 -LMV0PXW 0-LM0@SP$$EKF 00 00OdJMЍXW -LaM ``0 pᘥP@ꔥP@T iᦥA \00 c 1   ^@P(K -L MPCPß`8 < 4 =@ D0 幔PpfWp0@P0H0 0 * ӔP"FP " 0Q0W0Sz  H R @0 0R 0R 0S 0 P@T00P00S 20Sp <0:Sl  ,gzQ @ X B R00S 10S <0:S  0!S 00<00.0BS QX1 R408!41 10S610S200S <0:S 0 S 0000  B < 0:S:? 0S 4t0 L h00S <0:S \H0? D R0 S(KCCCP,PClWTPxP -LMR0 4 80 o E0S5  0 s 50S P -R l50S+RT-R+R0S@5@%004% u0< 0S%00S`04V4$P4u0D @40 0@d0d0@t@0$`0[40tA@-QPU+vP'<<44$Q0 4 `@  Pu` @t  40X0 e0b#0000003pw #0s`U t-U0ST8S@P3 t0  40.0 g0b00`0#8Q# 204 1R -Q 00:Q  P48 05p`OdrP@`:V@ -V0SP-V0Sy 0S!00010S 0:S 1`?`f8 0R0WV0S" 0;S0Sl!000S4010h1 \1R0248 0`(! 1 <0:S 0S5 0000000S@ 0:S 000S04 100 0S0  0:S @p0`0:S:`?`(D 80  `(KCCpWlWCCCCOCO -L Mk K -L M` K -L M 0U K --LM00  K 0-D0LM@P 00;:T  Ŋ  0h QE<-p0M0S 0 CR 0R0 SЍUЍ:00ЍD 0-LM0@P 0S,;P F 0 00 R r 1S010 CR 0R0 S 0  00h0 p-LMD` 0PS@ 3/0PS 3/pDD 0-LM0 @RP r 1S010   0S:P .FP 000 bP&RP0 0CP0P0S  0 U00S RP P0 -LM@P >A00 p-LpM`@T B lKhPP D @0  0: S EO0 0 A P Kp*dJ -AMLMx3B~KpG0dc,0 pGIJT3T N@P @EPPC0 P 0#S    P@  P  @2PŸ P 1 v0DTd P 1 g04S|4 P 0#S    P @ @@P 1 80DT P 1 )04St + A 8 Q@0-P' 叐P0  凐P0  P0  uPl0 mPP< h ^@T4 ,0 S DO(Kd3,DPPd\Hx lP 0-LM@P =P0PP0 0-LM@P &P0PP0 -40LM0SP P @-PMP 0 S \S@0 0SS0D0@SЍ MЍf*b*7Z* 0-@0LMT0S 3/P:PPlD@>E0DD -RLM$ @D0 0 -LM@@T p-LM PR @T@ <0S$0``P vP PD@D@p -LM$0`pPPᖗP@ 0(P004$0@L0000H0 L⊝ 0-LM @<Q*嵔00C?0 0 PPP 奔 P0 -LpM$s`Pc`LP0pKHp @  0P C 0PPC 0PC  0P C00l 0 010  P%L 4,00.R80M0S L040. S  ,0S00S40\0   <0S0 P 0  P000 K -LpM$@pP)R`S`PP!KPePP4 0R, 0R0 0R ,CP00P$CW@C@K -LM0PR`p ( ?@P@@@0P0 0p 0^10 -L4M\ `5P \ Rs04B00 0w\ R0@0  $ 0S 0@ <0  8 00 c@  < @0\ @S@R  0X H0 L0  0 WP0L H0  X  B00404BL [H $000S/S$0L 0/  4 <0sD0 D 0 D ZP 0  pi0 T P 8 $0  0.S0S 040. S  _PP Q%: pxP TB@40 04$0 :0 $0EB@ W $0 04  80 8 0piD0<00000 S$0*0  $$0 :0 $0B?00L0S @ R 04 0L 40 04@ R <0S P P $0 0L00$!$0L  0( 0 4l 0 0&@0Sڰ$0B8RS@  B@ 00  ST00P PP TP  P @PVfQ00c00 RL00  Q00c000S0 <0LS$0 0P RY400C40 4 00H0S# \ P0SR<0S $0P 02PP  $$0 :0 $0P0SX R00 04 0P SR0(KoJ000  %8 R 0(K$a -pQ00 W@@LMTP HA0 0;`BA@$0 4D T 1 T.P  W$0p:$0<0pS00/S $0` 9 X,@P.P   ,Q 0-LM@PUP10@S0 -LM`pV $0*0Q40#Q4 0C8S 0P$0݋P4֡ 04ơ@0 $04SGQ $@ 4 0R 4 奋P o0004P   :$0b000S  0AP @4 04  000 R P$0  `00Q0`V] R<0S($0@WP$0`( L$  /k/NAP P0S @UP k(P04 00 :4S S 0zP$0 AP4֡ 04ơ)@0 $0040$  0R/S@/00(  Lj P<0s @``60$ `<0S$0$4 $0  P ?@ ?@ ݊   L0P $0P:$00`S004P`,Q$a -0L M`p ? 4 @T?4@ 00v(UPP4P p 4P 40$`4 0$0 P @PXt PP 0`<0!ꖝ @P0L <  < $  P04X``V0 `@0` 0@  ATXY J` ^P `0 $$0ddP$00$0Y  -  (&$040 4(K舶,Q p-LM|P0@S $h080` 0 0S $80<0S $0@ph DDDMЍ/ *** -LpMKpa`P'0: S >P00(P P?80@100P ƏP 0@p$`0 @``0@PK 0-LM@=pP  00R00S >P 00PP 0J  =0 0-LM㳉p@P PPᏉ0-SM " 0\0  0\0 Ѝ -LM`Pp@3/P 6/P6/P@@ 6/P6/P@@ -L` M <0 0f8 D H0 D R0V000  0 80S'# f f40 @ 00S 00   00@ @p@0TP< 2/P40Z* @ p8 0R㖃' (R0B▃*8 1P <0 <0d d p<0 ez <0tp00S 00   00P8 @0B▃*p P 00S 00   00<p@T.< 2/Pf 00S 00    00# fH  0TP<03/P6 00  00 Pf0hpgS08S㖉)  c00 0j PefQ!Q  00 aWᖙ <0!U ጙ e8 %0 R (K -0LM`P0p R p  AP   @!R  000lRJ=0 0  0  00@ 0-LMPP0@S $<08K0S $0<K0DDDc*?* 0-LMP$K\CPU$0K$KK0 -@RL0(M0Q 0\ 0  h        $0T0p0S00KPP -Q0L M4 0R004 000 040`0S+ Pp @#P 㕒"0S P pt0 2"0S Z0 00 X0 00PU0K3`P(KPQ -LMP !@P` |` ᨀ,pP 0Rp„S0C \0 ^00P@-@MP 0SS 00B SЍ7;*7* -LMP0A Q@!` p0 0 B0&&EP00R00S 0/S9SV00 V0S` 0-LMPP$dEA `00 -LM`Ap  !PPP0U`VP -SLM`8  -= = = Kq 0000 00 r ̟00088 8 %Q 8 P  ]P8080 %0AUS `@@@@@@@@@@@@@@@@@@@@@@@@@@@h x4(H@@@@@@ T$h@@@@@@h @$ @d @4@@@4@<00 Q00 > UPU 0ʟ (U00#U00U0|0U0h0U0T0 0, 0~ 0 -P0 Us4P )1@0p P A P0 40 4PUUR P 00 0'UJ4P <ɟ0h@Ԙ0p P 8@ɘ P0 40 4P U U) P 00 000  0K4Kc0kP 4 d0d8 0K  0\P  00U 0K0U0K 0U0K 7?P 00C0000r 0K;00K 0)P 00C000UXp@\0 U P0 SP@L F P0 S S 0000 0 0K=0E 0K4K' 0K0P 0K4K 0P 4000K4K "0 000 000C S0K4K 50 s0K4K5Pm 40%v>C 0C000z a0Kc0PZ@tU0@ nP0$(P00 h bPT0$00 (d@:d0@ W0`$(0 0U 0 00 r 0008 Q71 r 11QDRd0 0v>C 0C0!000x1@S 0v~ p dP۔p3 0S\10 2) 00C0040 0!4 004 0R0 0% PG@{G@⯔@@e㪔P0000 c 0 S 1X0 00(Kl40L0 d` `0 P d@K0LKd0 `00S 3/$K -LwM 2 0(, 2 卋P`J ㈋PP`^`A,1,! 0$P@ 0@rK=~K 0 oK . ء ԑ \<KP 100@UP oK L 10S ~K3/` ,0 S 呔(KCXT -0LbM0K 0 cp" @!@KWpR^K`SP00 PNK0 0 ^0 K@f 0 S TKCT -LM`Z$P@K 0;P 00 @;pP@ ;p$K+O﷕* -LM   K 0K 6p K 0-L MP@=P  ?P =P  =P , 0PK0h -LMp`@P:/P U@P -LMP`@z=P6 pWgW0S+T0S S %W# PIP@  P`03/`0VU @#3P:0S`` M Ѝ/MЍ/M Ѝu5MP               |xtplhd`\ X TPLHD@Ѝ/U0UHUTUpUUUUVV8V`VV8]VV -LpMK@bP`  : SH  l0S4   KlWWWW -LMP : P -LM@P pnlhi -L$M@ Q< D0 R } z0 @w0 @0pB@@0iPI40 L >0\S+ $S7 ^S! ~S2Z0 D @0RT 0T:S(0`/SSP"  րP 0/SSL @ PZP0SPE0S  E@P@ 0/S7SP@4 T:)PH 8 @@pP\U8 $U%^U, ~UZ D0@S T 0T:Sy0`/SS  ዀPn 0/SSj @  0 bpcZ_  i pZ0 SPRR0 SN RSG CS( 0SD:7SP#BS=-FS4 NS/ ES6eS bS! cS TSnS! fS' rS! tS"@P @:P0QQ00C Q 0/S7S@P @ P @ P@ P@ PP@PH@40Tj:HP00@P8 8 <@Z(K -L,MD @0 D0`@@  0000PpDp @ PV DX@YDP @`  0"0S@00T TpN z'0 @Tp  pG DKP k'0 @Pp T0I0 S'4 D @ @e0DK as#. 0| t0p h0d @P00p40 40S\@P(KWWXTXQ: 3 -LMpQ@ |1Pp? T  0`P 0 80`P,Q. ,T@0T߄PP 6  0S,S00SQ000S0S 1`Wp@TP ||P+P0 lXtX|XC4@XX -QL M1`(0 $@ #P (P PPpp![0pR0Vp00 0S 0p0 P= hp KP8PPLp: R \R R 0 S S S0 S S  00 R  0T@pt95tP ,0 S `!(KVYYYYYY$ Z4ZKKN0CBK 0CL|8 LN B;` Tx ( X8 d\  *P U%PD%0S@ d  0YP7 h< ᢊ8 ( 0 p P D8 R@ <8 @80C88 Rpp`}၊P`P1  P/`(\8`%T(Pd p P |xHx PPH(W:|+d8APpğ0Sd02@ d @P(R d~'T*}|8H p0 SU 0U@E\S 0X@ U:;PftP}P^ dX'0fP@`XX d @T0#SS hPl(R PP0:S@lawP@T80T8 T0S*.K B0 B0CL p( t8 x = KpPo @0S :S@DxptT(d8PPP uP(R d&|puU u0:DL8 DLX 4 0S :S08 i b0( 4 00SPG:S:08008 0(0ecX(0hZX;0f pPg|P^ d& (f0f fpPXx `0H a@BV40(>V L| DP(R d&X8f`S0A0 P`6|R+p 00 L\(p^p`)|Ypp ,0 S ,圈(Kd[CdJDl[P[ -MLM4300ß,0 ,3,C0 <8 3R048 0@ S0.'P 2X "0S00f  P BnK`F`F┢{8h PP8Q(: +0P`8 X"0S00#3@ @P@Te&2 @00P@Z &PS8(0 S8( U0U E\S 0U:;@h P= 0hpP000S#S 8(@1f/0p'$1 h 1($NK@D@D P=蠟(K0pxC0`KA PA@0ps@T 0E'@u*t 40PS P0<( L{Te*$ P,0 S ,徇(KdJDp[X[ 0-LM@P0h -LM 0  K, K 0-LM4@ 0PS 3/0@S 3/0DD 0-LM4@ 0PS 3/0@S 3/$0DD -RQ3LMP@ :Q P*)W000@00V S P1 0S 3/0 R r 1S010pS000 P&PU  $Pp00S 3/ eq000'Pp`e |00S 3/ f ȅ `(V  T 0f0 0 0S 3/DD p-LM(0`S)@0P0.0 0S 3/50 P@0  0(p@Pq 0 00 0@T_S <0@T_ R 00c@_00S 3/pDD -LMQpJ)W0 0  -LHMX@K 0K Y PK -LMP0P :4 80 @tP> `P0K0  00pZS00@ % *,ntPP 000S8   41S  RRR4080@T 0S(K -MLM8 0( t8 t3\0(P,0 x | 0X 4X @P|8@0H ~Q낎KH H/48S  4 (|(`V 0X  1 S0q03R0SQ p@ xtP@t(U@࣢0a08 PRP4\X00 S KB.KA BxA B;8 >U`PLB0SPxK@@0 h(po h<u$PPA @nK`FH`Fp* sP p s0PZ00CS00Ӥ0d PN pL p @sPDt (0@P P\#t T@<$PPKt0C(0C8hp@ @<x8x@hP08(0@ ,0 S $A(K[[[dJ[t[ -LM0 @R r 1S01%P0 0C0 !ﴆ* -p- 1L]M0PC/0 `>KJK\1 0Q ,Q @L 0K 0 K{P |  0 cKx1 1 4 bp@ 1P|{P|dx00|1 }' 00@ 0 S ԄKpB[ -LM@QPc'00L41 0S 3/0 R r 1S01D p00S}%P W)00S, 3/(0`X@1@!  @#0P d  @f 0d  π00 0 d0ǀpX0000S 3/ DD M-L(M\PK0p@&0L0 &0 X0 WP`'0K <00PT` 0SPQ&0"S XWuv&0"S V U@@@@ R( K1(0 0&( K1T$0P`0(K[ -R00L MH /@ D H$P D@Q@  &0<0 8@ 00$3@0 pw 0-W@p4@  +Wp4 4 H q 3Q00S 0W0XSxSp H  R 0W 00H0 4@HTQQ ȟ@@ 00   0KaP4`P 0QH 0@Pb`0 000c00 < 8 00G S w_ 000Y W070cH0PRRN4@T" 8 V<U < 0R8@T00 P00S &A 0!<08@<4# 0QO%8@T<\ <0Q8 R00@P00S %A 0<0 8@ "@@ <08@<4# 0O<0 8@  pD@T RJ@ @D<K(K0`X0K@p P \ R 00`00h<j@P8{x P@ 04 ~ 0@ Q+0u@(KCQQ\ 0-LM@PP P 0h0M@ Ѝq- 0-LM@P%P P  0h0 M;Ѝ- 0-LM@P P0 0h M;Ѝ-MЍx,M P pRRxRRxRRRRRRR   Ѝ/ -LM`0@00\00`0 p-p0LM@`P>oP `00U ,0  phtP@TptW -GMLM50p ,0 np@Z p#0#S nOn~l5P0s SX5@  `0S 0@ktT5@ 5ZP00pDT. 0S4`(nP `Vl wP 0\00`h0KAEKt N C.KtF>K B0C$ $ 4 BN8 B4t x |$ $0CNA B4  $ h@T8pp#3pr~ P:X t=np@" NpP##0#S 0`4 t4 l4 ht d y`4h$0P nhPnYmgh00S|P<@K ᣀŸp x4K\@0C\\4H $P`|h@\ q!pX` 00`Z `  ,0 S P(K[CtW0\<\L\(ZCtt\\l\$\MЍoP0MЍ/|\\ -0L M @ R R R0ᓗ0 P~}xh h0<} R@0@0@ 41}( 0000K(Z]|\\],] -LMhbE 0-LM0@$K$ R10t!}p PLH1$ PL`R5x\x\x\[[x\@\[x\@\x\x\x\x\x\x\x\x\ } 0 |p P# @`R01S 0 | |  0|pP,T,]PD@ |K0|\\H]]\ ]X]]h.] -LMhEP0 !MЍ|\\(E0(0MЍ/ -LM0P003/MЍ/0@-QM@ Q QP0P0P0PЍ0 0-LM@P0S p lT00S P3/q0hq -LLM` l ptPDB 00 00htPPB 00 00x0S l 0!@Pqqk04,"400S0 '&P P0 PA 00 00pD "00@0@@8K&yP`` lh 04 X \ d@ %hK$P0S! kT0T0L0S 3/ld0 T0(Z$P 0@ 00l 00KqIq (K(ZXdcC -LXMP` t  x0 Q40d pP`l0 p   R0d R0h0 4 P0K| 0 P ( l 00C,̠Čl 0("Č#K0C<< >K<,BK0C0CI BD< I0F<, @< /bP PP"@iT <  -q( K0Z (Cd   KB@,0 /S P2pWi/00  ,8[Sn < bPi < b@P Wb@<@/L0pf@Y+<3u!pPED!v@P DP PNDZK;4<0N8, R4>0.( K0 ,C,<[/Sp  W @<  / 0 pfZ (0K?1 0 @?Rp0@`P@Pl@  f@@P?0S@@:  eof -0L M0P@ 0 (`K  !?@T| ~opd 0 P Qn/B(K 0 S HjKaaa 0-LMP@!1 1 !320QH0hbf0@-RM@P \4, 0L 0l51@PЍ0 --LM0 0 -LM@Pp T0` LLT  0P0$h   QE<xb( --LM0 0 P K 0-LM @zj0 0K,0 R0(0 $  2/0 R r 1S01,K 0P0S 3/K0DD -L M0S@ 0 0SP > 0 0 0p Wp  W 1+#,Pp`00`S0 040 00 dWp 0B<B S0S*0P`` 0PU:S`P 0 0b00P0P  UP! e0 0e P0 #0PW  e000P o W:,PP e qe0 0g 0 P00eS0[ pe0p40 W 40S   P00h000 040  0`0V`!PP00V0S  ;e000P $V ,PP  &e0 0f 0 P000S00 sP4 00eS0 pe0 @00 (K 0-0LM0@S0P-  00P @0P %\00P0 $000 0000S0B< S  0  0 0c0 000000X0MS  0S0 0S Ѝ/ PM Q 10C0 Ѝ/ -LMQp' %R`@@PU@ UP@  P 0Pg0 B T:00 -LMQPp R`@@ P 0S0B e0@T:00 0-LMP @?d0 0-PLM @3d0 -LR0L0M@@P T@ lR0  0 R B0 0 h -0LMS00 P@0Y.0D0TST' T%0 `TfPpp``UVZ W@@ W G00 g@0 0  00`(Ki* p-01L8MPPKA 7 K$ KH 0 gBp@ P $K g- $Kg0 PK)g4 Kg@ Kg(`K #pP 0S $K g4K g@K gu(KpaQ5;h* Bh*M0Ѝ -LMl0`p@P@T00 0S  0 TP @0S DD h* -LM@0Sp 5P-0Q 0 *P!_Z000~]P0 0P 4`4P4协 R @00>Oh*{Kh*P4M<P81#8181:P02410!0 < 8#" Ѝ/0@-RM@P \4, 0L 0lRQ@PЍ0Rh* -L M@P4K0`p| $@ PPFdP00P0#S  00  g $0 S Sf KXaa -L`M\,  0  \ |K yf! BB/A?/A0(K B 0bT 1#QT ` |K1Sr @@r v T` Qr v T`v Z`ZK p. ;v W 0WW10SG*:*W @T>*: W VZ Zh0P S   dMP@ mf@|KPd!1cPPpW00P0#Sv 0S ,0KR*:00ZK .0R:>0a @S@500 >f+/00 ,0 S e(K@a -hp(㗘#MLMh7 L1`0Pd ,0 .2$0SKNuK NAAP  Br>`1PQ0  )c00 e0Sd7S 0SPUtP0"$#PUhG ,0 S  e(K]|a -hp(㗘#MLMh4 L1`0Pd ,0 .2$0SBKNEK NAA0  B;`x30Q0  b00 e0Sd4S 0SPUtP0"$#PUhD ,0 S d(K]|a p-LM0PS1ó 0 X0 PK@`@T00 0S T @0S VKpDDo)f* -H0LM@TX0@S@W0  -L MXAPWLLP#pPJ   4P P/ ` 0P 4@0/S4@PP U lP ` 0K4K@px@4W 01`4WDPA0`FW@DV0W`(KadJa,D -LM0 -LM(@0S0P000M Ѝ -L M \4 P  000SL`K0`PK`T0KXL PU`QZ0=@P`  P2K P0= @@ @Q R@P00Y0X00Sz0<K@ K@  d 0P0SPPf 08 40J`0h 0RYx@K h0`K-P* 440S@0 @ 0P0400800S 0@0 1\ 0 0 P  B xP@x@ xP 4@4I0#S  ,0 S Y(KX?B4c -40LMQ < 0( ,MЍ/MЍ/MЍ/MЍ/ p-LM@PU@OP" P<\04`Kx0 @ 0 0(00<000S 3/Kp,XD0MS S. R > R\4<DLT0 0 0 0 00 000 R0 R000000 00000S00 S S000 00 00Ѝ/ 0-0LM0000PS@P P P  P 0h0 0-LMP@P 0S S P 0h0h0 0-LMP@P P 0S 0K0DM Ѝ 0-LMP@P0  >0h 0-LMP@P  P 0S S00P 0h0-$$ M @ ЍDEMЍ/-0MSࠓ 0C0,<4("4!<0 00 0Ѝ0SM0C0 ,<4("4!<0 00 0Ѝ/0 McЍ/0 Q0aM0 Ѝ/ MR %3 a 0 0% % Ѝ/MЍ/ 0-LM0@SP3090b0 4T 00 00 0-LM0@SP3090b0  T 00 00 -LM0@S0C0 ,<4("4!< K0 T 00 0K 0-LM0@SP0C0  KS,<4("4!<0 00 0K0 -1LFM0PQ,0 p@ K_K<N/K81 hpR 8!+A[WT081 4A `T041 081 `) .005@81V0OK@  >KP%  M?K@:P8!(VY@   >K&K?KU N/KP@ ,0 S )W(KDcMЍhX* X*vX*iX*CX* -LMh0`p@P@T00 0S  Tp @0S DDX* -L M0`p@P@T00 0S 0 Tp @0S $KDDVX* -L M0`p@P@T00 0S 0 TP @0S U$KDD)X*a%X* 0-LM@PtP oP jP  0hd0 -0LM (0 (K2/ KMЍ/ 0-LM@PT :T 0 K0  0KP00K0 0-LM@PT :T 0 K0  0KP00K0 -LM R :R00 -LM R :R00 0-LM@PT :T 0 K0  0KP00K0 0-LM@PT :T 0 K0  0KP00K0 0-LM@PT :T 0 K0  0KP1[0K0 0-LM@PT :T 0 K0  0KP1[0K0 0-LM@PT :T 0 K0  0KP1[0K0 0-LM@PT :T 0 K0  0KP1[0K0 -LM0@K0 P00K -LM0@K0 P00K 0-LM@PT :T 0 0S00 K 0KP 00S00K0MЍ 0-0RLM@& P0PeS 0P U  0h0S 0 P U  0, 0S000000S 0 p@T 0S @ 0@P0Sp 0@0  FQ00@ TP 000 T80 00S 0$ KDDDX  -LMt(B0S 2 "000"2@ 5` P0E%- 0S) Y 0Y$ E 8KN  48pSP   Sh!0S \1$7/D!0S 81 8!0S PE`VZ@T!Y00C0 S0@ @\ST 0@P0S 0$Y# @0S 0S x0(P0T00 00EP 0@ S00S 0,(KDDD X dF -LMpP`@QL10S @1 81@T 0 0S KSP3P 0@0RpP% 0@Q0 $R00 F P 00P0 B  pSPH0 @  @ 00S 0$$KDDDX M ЍMЍ=? -LM@7pq0:0 0PT:0 p-LM0@ `P  00: 0phR 0-LMPR?PP00OP0T@00:00 -LM0 0R K p-LM0@ `V  00Pf`0 ,Pʼ0@00p`P` Up p-LM8` 0PS 3/0@S 3/pDD 0-LM@Pd0h\0 0S 3/0P 00P00S 3/0DD -LMH`p@P0X@S8/pPUZ`VHF0 10M0S0C0R:Ѝ/ 0-LM0 RR@  P  100P:R0 b320 0 0-LM0@10 0s00R: 0R PP@  ! LX @0 1 0 -LM8 <0 P4 K00K@ `P? 00 i40R040 0  R5Y0S @VTT T  BR \ 0210 32@@0Q& 0Ppp T( `P 0@0y0@1 @d P p X0p 40 p040 a `P 0@0[ p40Q8a Z40 0S 00 pP008PJU00X0S XQ4 21@0PC 4 0T0 ,`P`p 0@0XPp  Q 00040 j "00p <K 0 } @000@ (K -LMoPpU 0 @ PIPIFP@ AP GPP:P4d 0eA 94 d~P8 2#TK 3T P 0TK8K<P 80S5Gd  0f@T=  7TK1 4T P 0y GCb46 56,ʠP0 LLTK 3T P `FVLǟPp4656P0 T@K0` 3@PV >F@d  6TK1 2T P 09 FCb46 56,ʠP0 LLTK 3T P `FVLƟPp4656P0 T@K0` 3@PV 5T@ PP 0#:?C0C PPTK@ K<0KW PH  <0@a@0T0@0 i@0 0< @0 @<0 Pn0U] U0 \P X0 4@lT H P<0H 0<0  R< r H0  H0 P080 HH 0<0 00dH* Q@  0S0\0 X (4` 0P Q d`  P B 0 ! HH0P 5 H  ! H@00d@0 @00|x0 @0S;ڼ 00S S S^" PH 000020H0 080 R:0 0 b320X H0  080 E"00 000X0S H\00P0  80R 008  @080 '"00^D00H P80<80 R 4H@8(K 0-LM@P0 1@0 -LMhp< W@ D0 PI?P@p I Ip700SD00< 80  80080 0Q `70S 88 `@ &Q `@4 B0 R@60S`40 030 0R `60@s3080 @ 0S0SQ  0 SQ@H @00SQ0a10c40 4 0PS pS(0+S -S 00S SP C >"00SC S40X b040 8 <0R<0F0ZCP0f0CI X 0 S S R0S yPP000'S S SQ  R0pbPP@@ZD0P 0P @T0U 0g R#1 0@00S=PP  0 0CP00@  q0Rh ^000Q@ @dDA@`Q@hP D21 03pQPppW40040 @aPP 4 d4 0 p04Q룠/4 RE40`cV) 0S S SVX HPQ  R 0000D bP0@0c_P"00`W@FpTp0 20 2p0f40 W? 0S S S70 2 000, 0bS( `PP* Z 00CX21 030S@ 1 0dP40Q4 p D P4@0 (K X0M 0@RZR R\00Ѝ/0A10M 00 R0: S:Ѝ/0 \M 1 21R  10 02SRЍ/ -L M@,KP0K0p0 c,0`0b2SzG  0=,$K -LMp` @E 00RP! 0 V0 0@ P @@ P 0 B %PP@ U @ @0 BP U P p@-0"RM"1@ 0`  00 3$ Pd05003$Q:R 00Q :0 0cC1S00Ѝp -LM0 10@ @R*0 S K0 @KM0S. 10          $  (  )  *  + , ! - " . # / $ 0 % 1 & 2 ' 3 ( 4 ) 005 L0S @04 0000 00 Ѝ/lFtF pFxF0@-@PM 0Ѝ0@k-@- bM@ l 3. P:Ѝ -2LM00< S@0 2140 040 8 4 00<0BP0 S SP00S p @ 0p X0 XSxS0 SP"`V= S%00S T0#03P0S T7`$0p P0 S0S+0 XSxS&0 SP")S00W0S< 00 )Q<0C 0 S> PpT  $ 0200SW+ T0#03P0S ]T  0 T000 R 80S 8 0 b 21040ASQ00(KX- M 0SЍ -8@LM,    hX/0c -LM,` -LMt,` -LM0 PR0P``@PH 00010p 8!#800"( (!( 0( \"x:0 0b 0("( #8!80#x \:W  0RPP@  ! A@0 1  M 0"108#8S"("$"""!   Ѝ/ 88S00000PM 00Ѝ/-0 MS10 0LRA 3#\Ѝ -LM0p100`@PC 0` P0 `6>03U<U@@5 P 256 b42Uࠓ>  0-LM@P0 0 S0h7LP0S @@088 100AS0 0<0D|FDDT  p-0LM0PS 08 Uʰ AT010e10 U ʀ0 0c1S1@0:P@ @`,00S 0<0 00pD|FDDT F|  -L M@Pp`P5 46 J,0 6,0 Q(  (KP, ( 0`32 0, ,0S  0 ,K,0 0 T C>D0C05 `0 C>@0C01B@`@ K -LM@P`PpP00`?0P@``dP6 p0!1  0 ``0 @P0Q Q @ ^ P@:0t @  P@0  0V: pG02S p(K -LM0@0 P` VpP 0!R 0010P n0>00R3:Q`0R0:0F0 -LM0 @R0@PP` pWP9 10080 0 8S:1 ! 00 `P00 4 Z 0 @:4 0@^0:@P`00U:8 pGW02S p(K -LM@ P00@ -LMpPoȟ0@)"0@ \0P`0 0Zo@Pp  ! >@p 1P  -LM@` L1 1`PK DqI ,APU 0S 18PUPP3 000S 0<帠开 8@P `p @T0S h8@T"P@ 0S $<P`d|)DFDDq -LM0e 0MЍ/F -LM@ ,0( P00 -LM(0 :1PX(0  XaA~8pP+  D dBN5q`A8P 1!0 1!(R 0  P1D 1D , Z00  ,0o -PLM@ 0At:00 -L~M41Sm 5 000  @0 P P `Q `Kla `pH 0@L1 T 0X1  0\! Pd h 4 p P0aK/qK.K-KLQH+QK,KPaTqX\Q*aK)qK(KP`a `dqh$qKl10QpaDQ `p4|q ⌑  ! 001 P4qtQ 4x `a pq 刑  !  0p1 @0A PR `8 a a$`p8q(@taxq aKp|,P1a1K`qp向!K 10a堑8qaK!( 11K`a pq Б  ! 嬁 01 `a ,` $pq 0pȁ @崁A ( P4Q , 8@" 0$ 1 P 0P` B 0(1(1 00Q R$1 !0$1^ 0S (1 8#0PS  0"P  1S 000P Q 00c0 1 0000 0b0 (K -L$MD  D8 @ 4 H0 0 u>`P 0 00P@< 7pW 8 0b\4 P: P$W 0  8 40 P'xS 0K0@ [P0@ 0 0 9>@PE 0 < P< X@0LSH0 D 0P0<:@Q3gg|g h0/ 0S  H0H00 00b0 P D H0P 0  P 8000(K -LMR@{01u00,1 0h: 0-LS00M\00SP@ Z01T00,10\ 00h -LMS0@ h 800,1QM@  0R:jiiiij jj(" 2 02 02 02 02 02 02 02 0Q Ѝ/5<*&<* -LM` 1pP @H1B@A01 s; P dm; 0200 0 0崜8q -AMLMŸP, p p8$ /T<Pd><PXBnK`F`F0@"8 P:?0yBNK@DBK @DA0A 04 _;& p   S;1sa 1 <4 1R& Y 0CA 004 -4[.$[/[0[0L LLL^0L 0Q( K0/4[0$[0A A PZ<` W ; @00%BT  - @ F : : 8$P0@<P' p 8$P O00 ,0 S n:(KxV,e e -LM`pyQ 0P40 00 0 ? Q< R @00%BT @ H : : .4 P0@ P p G P 40P O0 0<Z 0S 0 0C0pp/ 0R* Z 0CA 000 -0[. [/[0[0L LLL^03K/0[0 [0 003K/0[0 [0  P (K p-L M1@QP s0aP8 0,0ZP8 8<-Kp p-LM 0P8-`#1@::0C0$ 0\\1 8!$ BP@ T00~AB2AA 0B 1 0ph3; -L M404  SP0 00S400404 000 `0$0!QD AQ! 1 BN?p @%PP T 01C T 0 ! 0$ 10C0S  "0|X 0S@p T!D0V$0@00@c TD `Vu F!D1DD0 `0CD0@ 010CX$0Sc pPi!D0@0 TD0"`V1 v:R F!D1DD0@0CD0 ` 0 B Q~AB"AA 0B 1 05:    RQ00~LB2A0AB <0 0$ 10Q0A $0PD0 QP1@0c0Q51 ":K008#8#H! 04 :40P 00P00 00000P0C0@P0 40(K X) 0(10S$1 0 ! 0S 07P * 0P$1 0$10 0S07P 0 `P0 8#R `00 4 0 `(K -LMP@`QQ7PPq  Q0 Q000a0=7P^ 0 8ᲀ#xP`=0 R  0S0 ` p%7P(E000Y0n0@ 0S$10 (!$1 50S 0 7P ) 0(10P%$10$1  0h8(#h"x 0 0p 0S 00  X10 -LM@pAQ 4  n`0 PG(j+P- 0 QP #0 0S06P  0PP0 8#R >P00 4 0 P(K 0-LMP @p10K0 -L M@0 D <0K4 K `@P^40 j@KPwP 0@ T6PJ 0D pUpW 000ᴠ08#8 P(@"(0ᱠ00 @0@0@ D0@00Q@0A 8#8 P0 00@PP W000(K -L M`H0 00C< H8 H 8 4 D g< S0@8@#8@cH$H 00 T   8#8 @@0 0@ 0@00 DEP <0P< 0+p@4T # TH0X @ T@PH$HPdX%X 0PC4 4 0d0d00@ 0P00B0`008008 000C8< @ P#88 00;R008R#XH 0X0E8#X0 0@@eH$HX 8#8 B @0 00@ 00 DP `04 0 4 00000C8X#(p4(K -LMP `  a("Hpd0P pP5`PP  0 0b8#H0T ʲ0S T0 bP P -LMpP`@LQ\QQ4W@p T0X  Q00SP ô 0@00!0 0 0C2#00 0 0T00 WW 800C80R B 0\R! B@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R M00S:Ѝ/ -LM @! ? kKP, -1?P0S0@T0d p pGW0WXS 0gS80S @00P ! `K -P@ 00C>/( K 8C0SP0@ U T00SR`1S S S KeP 0S@@ -p@0S RP@ 0S  R ~00@ ,0 S 0(K.pe -LM 0@iPM 0Ѝ`0M ЍZM 0ЍT0M ЍO -LM 0@FpMЍ(32*/2* M-LM0|0`@p@T00 0S 0  ` Tp @0S /(KDD M0-LM0 0 0@ P1K0 M-LM0|0`@p@T00 0S 0  ` TP @0S (KDD M0-LM0 0 0@ P1K0 1*0 SM0 RЍ/p@-0MSP`P` D4%LP`\ЍpM0S0 C ,S R-S+SЍ/M0S SЍ/0@-PPM  00L S @#0C^00L S^Ѝ0 0-LMPK@ 0P  >00:S 0P 0<##00:S  0 P0 00K0 0-LM0P-S@ +S@P0 T00c00 -LM0@JS000 #MS00  0P 0.S! 0P 0.S 000C S00 [?mP 0/S 00h}m  -L MPp@0  d-P000 -p30 0S# S Sf 100 2" `0F40  1:C=C00SO ;RMX1@H0@!B0ß40 QV@@Gd-dP- @ -0 @-T  U0B0C@s-0P S04 0 \@ B1Q \000 O0O(KeQ 0-LMPPa-dEA]-`00 MR10bQ1bQP00Ѝ/ -L(MRP0 L PP 09H0D LR L=Q:S0T.U50S8 ( 0 5  00S9P0 8 80080 U0L SPE 0S 0<0R 8 0"4 < PUZ8 < DğP 00 D @ !H` @ 9$0  Po0@0S@T SUQPRZ 004K40 \P04pß0Os/# 0Sl lK:>Pl ;0 l0 0 0 ?S p 0O /?0@ @  `cP@a0P`Z@P <` Y@ < VU@p < @K K03/P <0S@0SKlKP- @ K R  S ZʎY@ < R S ppS~R|@p < ZxYuP@ K pїL RJx0SG 1\11pW_  =0A☐K3 L0R- 0=0P`BL0\ @0K 0O0SO80 4@ 03/PlK hPx L0R80K@0 <@  PEV 8K`FJHZ@ K PoSR ?!0 @K8P 4` @P <` 3/P00@K(Klene )) -LMp@P`40S 0*K@-p0M@ 09H00 NS N0S: 0C"0\ZЍ)P@ -MLM`P8 <( >0 0 0S0 000K 0Pz 0S 18P11Zm B.K0 B B0S =0 B@4 P(0K 4@SD4xp4x 4(KR B.K B BD( ?Dx 1員! 0S@ , 2DP圥% p\! @ H @H L w3Lx dP00 S@x 0 0` cq3 4xX8<(00K4 Y (K ))L*H*P 0M 0ЍY P0 0M ЍP -P?0LMS+? Q0S% R#0.,0 0St0 0Sd0 0ST0 0S D =0p3H*L*T*X*P* -FMLMx90P,0 9Kp`&PI 0U00 *P 0:S /P  P/S .P X0:SP0/S +* P*BNK@D@D++*+)+)P p@ L(FPPUIK966,`fV @FFH`fg0`j6f(K$! $(@ 2TQ Q\K\P2P)K6SSYY 0##iKf0 2"0#"KF0aS)KV`@v KPK`P@0V0 SL&00@P9KV`0S0o 0PRi@`0V 0e 0 0`R K&F)K0%P09K6S K` @P0X9K' IKFT@ 0S0(` 0QK' Y 0S0` 0Q @0 UT00CP0S )K&0j@c)KF 0 0 9K6RIKFTiKf PiK&9KF6TS0 SIKFD0 S}00 SyFLK(@D @D Po0Sl 002Sg0#qK0(A00000 0  0  0 P ``V FP*Y`e -RLLM`@ ',6p@ P01h0 @000 0<S @>L0>Sv dp@ h 4p@ @d h@ 0Si 0K@Pd  \pP00PU& <U @>'0 >SP dl@ d  l@ @dd@ 0S,S ;S 4KdP;00>C40 0 s 3W4 R0;S,SHK dP& 0,S#\K[P PU|ğ @M00@H04 ` h0004 b 0a 0004}0Pp0(PPG0` H0K c4P@ ` \0KZU T  G0  G0@ P 0G G0`00 `d %P`%p3"1p QʍP`  ` 00KSځSB0`"0Sh20c Q0TBD  0c#0S ,rR( R0 0h!00 0S0 0 n0O0@0 Sb0 \| @M00@00 4h081 b 0a 0 0 00C00͆@00 00 blP  000P0PlPd h0d R d00 0 0 S pv&dQ h d0 l j&(Kf$f)H*L*eQ%X* -LM@ P  hNe p-0LMD0@S`P 3/ 0S 000P \0H0S P3/T0@0 V80T,0(0p=0(0pDD**B)Fe MЍ* -LM@  -@0LML@\, $$, 04f|f -lLM0SX@0 0R@P (@ P hz*)B -LM,@D0S 3/H0S 3/DD* p-LM,$@PphQ0S Pp B$PP ,B$P0SP% PQ0  B B,l%$ P` 0:S  P ph*))BP*e p-LMP`D0@S @3/4 H0@SP 3/pDD*  P0M 0Ѝ p-LML`D0PS@ 83/w H0@S 3/pDD* -@0LML@\, $$, 0<A0 Q@l0#[[[2[x h[$[[4[xh(KF -QLM`p`pp$ <0?@P $0 X0AAQM Q0!0a0PЍ/-RM \1,0l00 ?\0 00Ѝ-RM 0bR12<0 RQ ?R0̑030Ѝ@-SM@ 0l\4<0̠ \ ?\ 0 0@\ P R  0 0 0Ѝ-MR ,0l0>ЍàS-0c02Ì.1M0 00Ѝ0M S 200 Ѝ/M0 3# R02 R02 0Ѝ/M bQ B2c00 Ѝ/@-M @0cR#3n P0C2Q0C2 d  l 0Ѝ0@- H. !Q, H@ ,P2\Ƞ3# MЍ0 -LM@,pK` 00K(PK 40K(4 ,000 ,( 0 K -L(M8pK4`K@H0  <0KDK 00PK@@K4D 80e  00@ 40`Z H 0@D 80O04 @0`I0< 840 000(K -RLM@`P'"xZᔀ 4 K80Kf,@K0PK4 800<h0H0, Q02[Z$KP1#3P1 <2MЍ/fPQMЍ/PM3:00QЍ/PM3:00Q#2Ѝ/QPMЍ/ ;; ;SMЍ/p@-9`\@T0 QMP R ,@00@0000#Ѝp p-LM`P@@@`@p -LMPP`p P0`B53A0Q B"A0E0U00` EU0 u @@ 0@dpP@$K0@-@_Z@@P  @PMЍ0 p-PLM 0 o@a@I PP5Q 0 U0S$0 UZ$K e 0KAe $0Kp0 000M Ѝ Ѝ/FF -LM, X"`@pt3Z00 P T  W TTV1("SV*0U,!00QsLPJ T 0W0T0SWT  !0Wx0SU0u P ,0 :@KDK T0Z@ D0 H)@0 6 `H @0 0@K<0DK48 0 @0`DS :`@KDK@HKDH 0FH@ D0c (K -LM@p`U =0S0S00SU -;LPp45gc M3^@(` ,0 0U0/@@UPpS3:V:00S00O2WS0"?DE)U1(0 n(( K,01,0 , (0( cUV W1,0 N,, Kz(01(0 ( ,0 cA@ KF -;LP`45f M3 à^@p$0 ( US8 V2N(0 (( KI!V\?DE% U2$0 n$$ K6U FU 1?"C   $0( 2 N$0 A A2@K -顏OLMX`p P$K -顏OLMX`p Po$K/RMЍЍ|/RMЍvЍ -LpM| x x 0 ,JPJt@ %Jt優Cʠt \oOp&tP|@㪪<@ 8 0P D @ 4  @ tPZ t   lCZ    0$Z @tP0P 0DK4 K@0K00S 8<0 00 H, 5@KR0Р  R0 0ᨀ+ 0P00 00   0@OpP@@ W00p (0 S (d$KkjhjhlLk$kj -D0LML@\0 ((H 0MbЍ/ -LM@  P900H9 -LMH9@SH9 P 0H9<@M<P񟗈$444H4@44\x4444H4444 44$44444444H4844Pp4444H444444D!(00 S(0<H$!(00(0C  1 = 0 0005 *0$ /  0 ) 0S0C# 0S00  h0   P0   80  0 1 Ѝ_Ѝ/@l - 1LdM0pP0 `z0$@Kp zh@ l 0 pVd  L ` j\ 0`0 0\0 0Pp X0 0T0 ]8@KUL H@ DP  0P PD <0pK @0 0<0 o@9  Ql3Rh. -LMP R0@000C0,00S 0 000lDDD -LM`0 PQp  R 1S @@b00  R l r000CL :#:3 201 32  l@lmm -LM 0PC  J0 0 b00刡 0@ 0 `0D @1p0W00  v P # 3TX0#0300 0 p (K4m p-LM0, 0 R@ t90\ p ^P`BD0A1.S R00SRPp@Lm -LM 0`^0 4 9~NP ,1@0鎐pPIp= 1@T  0A !0S0@0p W:P  0 P00 00@C 0B P00!0004  00C0(Kdm -2LPM"@0`, 00(lpKV V V P,? P+( K0PD`C!P#PPD2PSP sP0B (BT@P(T@P(PU P`Vq P,  P` 1`P@;  \  XhU:Bc<0 0 (1`P+   0 0RD\,0Z0$%Z Ut)0@ %00S 00S l _ 00 ,0 S <(K@lmmYmm0@mDDD|xl -LMhŸ@, ^`Pp00 t90T 4>0>0R  Q"1Zk1(A, 0 AT$ U T  1 S 1Q0j10S   0S  0 R /%B?^X( @Q 600S   0S  00 0j01R0j1 0S0S  hU@1SX Q@ 40P0@U(K@Lmmm ->0>0LMR4 Po"&10 ( 00S 4Pe 4 10c0 R0 ``cMp0CAP 8 P8! 1V0a1!0``a 1pV0( B$ (0\:*0AaVp 0S 4  0S  44010  !101Y80( Y4 1S$ (Km@dmmm n -LMPpsP *"*R@ R B0B@ Tt=$0a S:X\ Q TD51 3:,3`V a P p R 0S R>0>$ 0+ bu . . & o0 `ST  b` `V<  p 1IW  6 0S& T$ P ) 0*"*R R B00@ S15 05c0 P #0S Q1ypW `PL  @Op !0 1!08#(R! *1 S1D1!1S R00 1Sp00S *V1S1100S00@@@DnTn`nlnxnn$n -LM`Vp P0S 00@T 0S |0t x0h 0SL)0 h00C00S 0pDDD@nn - QL M8 < `ᤦ]$8 0:CR*80p>0^P <0p@@ 000 IP  뱮@$Q a ] P 6e0S $ 0b S*0S b; $0< c:b0Q@\ 0SV V`%0SR<0S$0$ c g bF, 0 Rt90Q  80AS08 R 800C10+ D0P0U40 *0p Y:3), 1 ""p  0 W0 ,4 @P0 p0#  0@8  00S0@@00@P 1P R0000  0U 0 *`]Y# ᰑ01 R1J438#811  P  A0S00PP`7:39 )8#8!1Ბ1  20 BR 20!!! P4 0S00P40 P ;0 4@b 0R,1S>@f@!T0B@p$200P0@ >8#Ƞ@T@.00001!0C8#8 ,S!1 R00 00p00c 0!2Qb 1S @@@@a00 x 0S1S  b 0@< RT 80S 0 80 b (K@`nLmnl -L Mp4 @0GW PPU0 P20S 2嘂`VP`0x"0SL)0 0D S 05@0 WT!1 0 @^$0:CT:@/ W:Z  >00Wg  0pP_ 0G0 g@T `- P x 6ePa" PT 00# 0;PP  룬@0$Q a N P  0S$  b2 00C000S x0Th00S l v00P040@oPm000@(KDDD@nndm`n| -LMP`V`10S P1Hq@T;PPG@(1VU3L9:U NP*00S 00PU )* 00(0 R  P0A S|05 050040P0C0L00S @0U000S ( zDDD@o| -LMP0p0S 0`@TPP,@0 0SL)0 P 0E S05 05P000P0C0L00S @0U000S  0뵫pDDD@$o| -L,Mpᦫ850< S $5EXP@;0@4TL9@ S@/0G S45 05p0Y  0@  P8   p4$`0:CW:k@ 008 :#:S0 S0 0C3 SSf *  W@0p 0@  W ZYSPU@P 0>.0 N^@PU]VPd@0 H@ 4P H @P0@D0 3HPP:DP  P1!91 !0b1 `@"(0V:`@H4 2P`@ H`P@4@ 2P0K @HPT h20S4 8` @pst9 4J P4  ,*V f `P@  !$ a| P  o e0P80 @PG W0S f gT008  @07 WW8!0S0S00W0S&  Z 0 c W!* g6 W00S 0@P WZ Z 1 ! R0  0 c Y @00C0T00S H0T800S H [p?$(,(0!4 180 A<@,QPaq0V4p00L@@HL Tp(\(#0P!0@  "@ PX@(@( @40 ?00, 0R (KPPZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 M Ѝ -L]M@ PMKpKKC/` `4 0 jTAM_KPE@l0D@K\0 KQ | Q 1 0 0R K| 0-AMLM00AKA@APA 0  04 d+0,f+b+^~B^KPEPE @A  $D D (D : | Q|-R0 0c BSR48 R p-@P`x BRpR0 BRRRp&*."*10*2 -@LM\:0S@d0d S0!* R0 B\0`M 0SbЍ/RM0S0  R0S 00a@Ѝ/w* -LMh0`p@P@T00 0S  TP @0S ҡDDy** 0-LM 0@0 @PdK0I*@-pPM`P 0@T00 S ^N \0dC10 P  =\ЍQ -0LM0 0S=S` K KKF*JB* 0-LM 0@0 @PK0)*:%* -LMh0`p@P@T00 0S  TP @0S *DD*@-@@ 0 0C0S2M-S0!1!Ѝ/0 00M100 00 Ѝ/ -LMAPTpm%& R0 W 0 0PX@ P  Y 00 AT$K -L$MR` X 0SR D @ 0 13 B1 80 0D0 @ 010s03@0 < XQ 1U   01 0Q0PQ!0Z000 R00S 0S S0101S 1UT0P  P LP" 1S0C1\0   P0R 0S00S40 0 0cPs 00<3 Q B  1 001% p # 40S0S00S40  0p3PC p00 p 10!00@0@@T00Q00001P0Q =U0 P @ 0 Z00 PZD< 081  01 0ā0P(K -L@P/ 0[`p( 0 A 0P-LYU- 0- L@0@PlP $000A -@L;T 0A -OL@ PO -0LM}@ -LXOpenBSDUsage: %s ..., where is one of: instbin%s: %s not compiled in mount_cd9660md5sha256sha512dfmountmount_ext2fsarchsyncnewfs_msdossttylnpaxtarfsck_ext2fscatifconfigsysctlping6dateztsscalemount_nfsfdiskgrepegrepfgrepumountmount_msdosfsckmorelesssignifymknodpwd_mkdbreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownchrootfsck_ffsnewfsrmmtejectmkdirksh-shencryptbioctlsleepmvdmesghostname<Ў|8[X@@ ą s@@$ unknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %lldnonenoxferunknown status %s%s: illegal numeric valueunknown conversion %s%s: illegal conversion combinationcbsconvibsifobsofskipstatusnoerrornotrunc%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicesstdoutinput bufferoutput bufferstdiopledgecase conv and -DNO_CONV%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %lld bytes transferred in %lld.%03ld secs (%0.0f bytes/sec) skip reached end of inputmainldusage: mount_cd9660 [-egjR] [-o options] [-s offset] special node session number is %s: %segjo:Rs:realpath %scd9660%s: Filesystem not supported by kernel%s on %suserquotagroupquotarwnetautoaccesstimeatimeexecsuidrdonlyupdateneedsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'digest_file%s (%s) = %s usage: %s [-bcpqrtx] [-C checklist] [-h hashfile] [-s string] [file ...] error encoding base64cannot open %sstdout: write error%s: read errorstdio rpath wpath cpathbC:ch:pqrs:txbase64hex%s doesn't support %s ,stdio rpathunknown algorithm "%s"SHA256SHA512 df: %lld: %s usage: %s [-hiklnP] [-t type] [[file | file_system] ...] %7sonly one -t option may be specified.empty type listhiklnPt:-h and -i are incompatible with -Pretrieving information on mounted file systems%s is not a local file system%s mounted as a %s file system1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on Filesystem%-*.*s %*lld %10lld %11lld %5.0f%% %s %-*.*s %s Used Avail Capacity Size1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted on%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s ext2fsprmountmountfsmainnfs:@ufsffs%s: fstab uses outdated type 'ufs' -- fix pleasemfs%s: fstab type %s != disklabel type %susage: mount [-AadfNruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node -o%s,%s on %s type %.*s%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmax%s%s=%lu %smsdos%s%s=%u, %s=%uuidgid%s%s=0%onowin95norripgensextatttmpfs%s%s=%04o%s%s=%luinodesstatfs %s on %s type %.*s: %s already mountedexec: mount_%sfork%s/mount_%sexec %s for %sno mount helper program found for %swaitpidstdio rpath disklabel proc execforceAadfNo:rswt:uvrqnoautogetmntinfounknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./var/run/mountd.pidsignal mountdasynchronousasyncexported to the worldNFS exportedanon uid mappingexported read-onlynoatimenodevnoexecnosuidwxallowedwith quotasread-onlyroot file systemsynchronoussoftdep/usr/sbinmainldusage: mount_ext2fs [-o options] special node o:specified device does not match mounted devicefilesystem not supported by kernelmount table full%s on %s: %susage: machine [-a] usage: arch [-ks] machinezaurusarmOpenBSD.%s%s main@@@h pp p ` @  $%s: no default %s%s: illegal %s%s: bad %susage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype] stdio rpath wpath disklabel%s: bad FAT typevolume ID"*+,./:;<=>?[\]|%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsfile system sizesectors/track/dev/%s is mounted on %s%s: block devicewarning: %s is not a character device%s: unknown standard format%s: can't figure out partition infoioctl (GDINFO)%s: can't read disk label; disk type must be specified%s: unknown disk type%s: partition is unavailablebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectorstoo many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs=%#x bkbs=%s: can't read sector %uNO NAMEFAT%uBSD 4.4%s: can't write sector %u160180320360720120014402880   $ ( (l0 8 <  D L  T  \  d  l t :    $ , 4 < D L T  \  d #l 3t #| 3 2 3 3 # @ @D@ @         (08@ H P@X@`hpx{  $08@HPX`ht@@@@     (0@8@@HP X tC$`ChC$pCx  @ @(08@HPprintmainoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sdiscarddsuspeofeol2lnextminquitreprintstartstopsusptimeflushrprntillegal gfmt1 option -- %sillegal gfmt1 option%lxcflagiflagispeedlflagoflagospeedgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d TIOCSTOPTIOCSTARTTIOCSETD%d %d rows %scols %sospeed %sispeed %sillegal option -- -%scbreakcolscolumnscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedcs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeot tablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns;lflags-extprociflagsoflagscflagscchars%s = %s;%-8susage: %s [-a | -e | -g] [-f file] [operands] -aefgaef:gTIOCGETDnot a terminalTIOCGWINSZeither display or modifygfmt1illegal option -- %stcsetattrTIOCSWINSZlinkitusage: %s [-fhLnPs] source [target] %s [-fLPs] source ... [directory] %s/%s%s: disappeared%s and %s are identical (nothing done).stdio rpath cpathfhLnPscmplabelduid_parsegetasciilabeledit=mpsavehas_overlapgetuint64edit_parmsedit_parmseditor_resizeeditor_allocspaceeditor=\H =,=8=@=H=X=`=h=3p=x= ===<<===hhVV<VV3<<<<3<<<<<<<===V<8@3 WW<dU< W<<WWW"!5E)[o8o8 ,ޅ/x{ыs5^ŗP ] ը3܃0ޝFՀާQEmtG,H$JcU]:N3sUrj:woz]Nj~&PIFQ6euQ3iM_>9=ʧ>LG)EwET>Nh;0,QBo`Hˣ8ͣI? uo;I>G!4F%QG9l ,:%]ؑ{l,m"1:2 S<^B㲊Weͷq  .XTU8㉬/x`R|^V+Ug8uV6&KUUf,1dv u<9 Y`Hetqmj9`tQǙMh#q`R,bú6_ldvD,<ǀ0Y_aj y٢,fЪlf=3I&yd(Ć<$U6ӆP /&K@E"cPM]t^VW^@eBܐ(8T'|vπ-nvŘ=sz8+a%>@Cx7vfN m1l<.aDVL pj0?)N-|$>!32;`48 ,96 a'Wk]>`A`L_\t¾Vp344>NitIitiC {K`֙7 > aOڍgV 5$Xo-^}EɪX:ۨ*C}DleQ81lI \(\e`("53l!BBw,Y:juoEyWke OzpL8$Źy,@F7*=\YצH^ґSG@E Aqm×FW<.FwdԊT ^׀"PC z^*p@w~Wx:FێB/ywb1Xm, C`frLJ6ϛX(ճfpj]m.w8S{¨4 H%MHMlqy,/gf5 e?,Fp> u_Aa[ :Yaɲ~5G!!r !a7WZw0M+AgI>G;Xx]epa6rǧgyvp& SYYl-3.=UWYrK~ⲭIYQ'}3FA2ꂭ7b_$TÀgkߴp)@K@}ԾaD<Ҏ]jQwJB' mڶ޾#A_CqZ~/,h+(^f iVQ\2Kd_ƻ$rkǴ[%&cjCցJGqSs鐮, Q?Xqs5^iѢ { $wH;VIlNk[D@de2 J܄bUC,) -j3]Ck ECQf*I/4k\6e,_ǫPb左$'g$I3IT䪸 x;X%)l xO Qwn #| fzU0#`73{4!#peyCZZQϜVrDJb#&'\ @󛐪\a@AUŰ+{\#&o0 A˦K\n Me@lt4˕;6CZ85SocraFe9Rn16'OȄG:*[~tkx4|C{DE͏kX <\r(jrL"8a}([O:V$WQNS`dǡ6 e7HMl%z@R+'|Lw& eGhWt{2m:{u}56R͘0&٘Kbz=hv4VrLq|K`Fv5|*-UjW,]k:o%e7QIIE\F:Q=HR[B5kFKrمۑ+nw.wǘ$WnTXxɦ]h( )qfXZc@x&YVEӹȘ[2T BIO~Q` /]Aj'l< !v rA(W\ө5EJIOūٽzo{dt(&z>$EuK

w!&%x)oV}u-C^f+X/XeƙLh[Q5փa`x7TY Uiv[xXO3-=5UJpI9s̀oyt?lsj xh#{<(z~룠 iQńVu+L"妇i1f^/ɾ/ffŦ\\-,]6G$MfQ”P &}K~d.uת]0Iِ"TSiVE3`rL_G.T-&L01Zsݎ}D- *r3Cؑ I=PGM] |"&[1%rqb;ܸ|KbfC,6!sOeu+wG*U}j) \pKSU6-m\>!ď&-Vv(+Iڠ=z--߸Dwk[/;홗*el_*X=n?O?E"efٟCnS~NRQӁ!M9OPdE"Rbv&Mi-rksmOBpH6 "?QKS1}|Uzk`"t A+!*%Dmya1(-;A ?^C_ 1 {/ $eS#O=}?asg{m8ƀ:V<uT]j,t:EPYIgs[ޑN݂S |E(H6c믢@$b$oYZmr3b[7@08iW.[HZ}tfI!F; R DA1?=ӥP]O)hij|@ټVRAc &E3Zj:=@HsNJR/pa[6bU8JKˠkxF9bGx-=9h_]͊7qNot5vL۵k*j%vc.bj W Ùژ]ϙc)nC2t5]F1 Nf޽0?w^lm@Z !UڄM˘gi%pg{kUS{k Xq&٩8N}.K΢36z ` tZ-mV'C#1f@Ox8fXLR 5AV?}bA*A#ޝr>&%%3Iڹ%O}%i䤌~ }|^(ݜTz$ .#G =m<- 'ހJݧ?_ ԣef:}ZTH L@=;#%O㡒ÁϾ'Go&_ ^Gwoڻ'dPS* 긷UqLЭ*+{e/`"L~W`چ̏8 |!_S{hs3Q}:mo x5=atBﺋbu_;QAמ͍ICɳGqY$/g3]5o`r?Mi&1`oHq8 qoTx~̾ 瑉BATi'qsP&kmmЎ!6fu%c^+Vte(3Cl'#@ˮ2_#|"_{Ґt! sx0FC`2 ;<-h8 4ArWYQuJB .msU-t/sU ^ԩKmFR f.lvd+m9:8|uwB(*3k1+cSˡA$dje~* a⮽'w~$߻\ljNs[f*\ra=dyVKc'䰰5pH_ɰeע3ԜgR,pZd] UlxQƄ Vnioqxk[cPM{rF? $bJ؆Oa8Lۿ~zy]Ycz=Ov˫m`j~;5\E+HJ/$ Ӫg+јB _R&]oqgrzx{'l3_{4a'95:9{5DZz:'b  1pN0P6+Aذg_>$+ˮabBo%'czl&0T n{LJjott| K=TCMdusage: disklabel [-Acdtv] [-h | -p unit] [-T file] disk (read) disklabel -w [-Acdnv] [-T file] disk disktype [packid] (write) disklabel -e [-Acdnv] [-T file] disk (edit) disklabel -E [-Acdnv] [-F|-f file] [-T file] disk (simple editor) disklabel -R [-nv] [-F|-f file] disk protofile (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %llupartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %llu offset %llu line %d: syntax errorunknownIDEESDIline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsduidline %d: bad %s: %ssectors/cylindertracks/cylindercylindersrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seektotal sectorsboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sVISUALEDITOR/usr/bin/vi/bin/sh%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%cboundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] offset%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aioctl DIOCWDINFO # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: unknown disk type: %scan't get mem sizebckmgtBCKMGTValid units are bckmgt AEf:F:hRcdenp:tT:vwstdio rpath wpath cpath disklabel proc execstdio rpath wpath cpath disklabelSMDMSCPold DECSCSIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDrdrootunusedVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDF-cparse percent %s: %s%s: parse error on line %u%s: min size > max size on line %u%s: sum of extra space allocation > 100%%Treating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. OpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Can't stat deviceAvailable commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize auto allocated partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 't' (terabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c%s%c none swap sw %s%c %s %s rw 1 %d failed to sort partition table Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] %s: [%llu] %lldRounding size to cylinder (%d sectors): %llu fragment sizeSize of ffs block fragments. A multiple of the disk sector-size.Command aborted Invalid entry Error: fragment size must be a multiple of the disk sector size (%d) Zero fragment size implies zero block sizeSize of the partition. You may also say +/- amount for a relative change.The size must be > 0 sectors The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).%s: [%s] [d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.BIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. Where to mount this filesystem (ie: / /var /usr)'%c' already being mounted at '%s' Mount points must start with '/' FS typeFilesystem type (usually 4.2BSD or swap)FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Unrecognized filesystem type '%s', treating as 'unknown' Size of ffs blocks. 1, 2, 4 or 8 times ffs fragment size.Error: block size must be at least as big as page size (%d). Error: block size must be 1, 2, 4 or 8 times fragment size (%llu). Align partition to block sizeRound the partition offset and size to multiples of bsize?Rounding offset to bsize (%llu sectors): %llu Rounding size to bsize (%llu sectors): %llu The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx The disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. Possible values are:"IDE", "%s"Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, ST506, or floppy."%s" is not a valid disk type. Valid types are: Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).label name15 char string that describes this label, usually the disk name.The Number of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) partition to change sizeThe letter of the partition to change size, a - p.Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' is not in use. Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. partition to deleteThe letter of the partition to delete, a - p, or '*'.partition to modifyThe letter of the partition to modify, a - p.partition to nameThe letter of the partition to name, a - p.You cannot name a filesystem of type %s. No space left, you need to shrink a partition The letter of the new partition, a - p.Partition '%c' exists. Delete it first. partition to resizeNo such partition Cannot resize spoofed partition [+|-]new size (with unit)new size or amount to grow (+) or shrink (-) partition including unitAmount too big Partition %c shrunk to make room No room left for all partitions You need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.Label editor (enter '?' for help at any prompt) unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?unable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.Original label and mount points restored.Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) /tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homelfsadosntfsudfsdFLOPPYxdhdVNDsvndar_revar_drainar_nextcopyarchiveappendextractlistset_crcnode_creatls_ttyls_listabcdfiklnoprstuvwxBDEGHLPTUXYZ0rep_namemod_namerep_addsig_cleanupadd_dirchk_ftimeustar_wrtar_wrustar_rdCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specForward positioning operation on archive failedCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace tape %d blocks.Failed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUnable to truncate archive file%s%s: Waiting for tape drive close to complete...done. %s: unknown format, %llu bytes skipped. %s: %s vol %d, %lu files, %llu bytes read, %llu bytes written. could not pipecould not forkstdio rpath wpath cpath fattr dpath getpw ioctl proc-dcPATH=/usr/bin:/usr/local/bincould not exec %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %sUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...Cannot chdir to %sCan't fchdir to starting directoryUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUnable to append when there are archive read errors.Archive read error limit (%d) reachedCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableUnable to allocate memory for group name cache tableUnable to allocate memory for user name cache tableFile changed size %sFile %s was modified during readFile rewind failed on: %sFailed seek on file %sFailed write to file %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryCould not set permissions on %sUnable to set file uid/gid of %sAccess/modification time set failed on: %sUnable to restore mode and times for directory: %sUnable to stat directory: %sDirectory vanished before restoring mode and times: %sUnable to close file descriptor on %sUnable to copy %s, file would overwrite itselfUnable to remove directory %sCould not unlink %sUnable to create %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %sCould not access %s (stat)Unable to link file %s to itselfUnable to remove %sCould not link to %s from %sUnable to link to %s from %sA hard link to the directory %s is not allowedIgnoring unterminated pathname at EOFIgnoring too-long pathname: %sCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sWARNING! These file names were not selected:Invalid file name argumentUnable to allocate memory for filenameUnable to allocate memory for file name buffer%b %e %H:%M%b %e %Y%s%s %s %s%2u %-*.*s %-*.*s %4lu, %4lu %9llu == -> %s: unknown option %c %s: %c argument missing input compressed with %s; use the -%c option to decompress itbzip2compress7zXZinput compressed with xzInvalid option nameUnable to allocate space for option listInvalid options formatusage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory Invalid block size %s/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578TAPE-IUnable to open %sUnable to read from %s-CInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value: %sab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cDestination directory was not suppliedThese format options are not supported %s = %s ustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archiveRemoving leading "%.*s" ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %s CPU time limit reached, cleaning up. Signal caught, cleaning up. Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.Unable to set up signal handlerstdio rpath wpath cpath fattr dpath getpw ioctl proc execstdio rpath wpath cpath fattr dpath getpw ioctlcan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory for directory timesCannot canonicalize %sUnable to store mode and times for created directory: %sNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryCannot allocate space for directory access time tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableHard link table out of memorydeferred symlink hardlinkdefered symlink hardlink pathsymlink tabledeferred symlink removaldeferred symlink%s: %sdefered symlink pathdefered symlink valuedefered symlinkFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sDirectory access time reset table ran out of memoryUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %snobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sInvalid extended header recordInvalid extended header record lengthExtended header record length %lu is out of rangeMalformed extended header recordlinkpathwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %ssummarypr_packpingermainusage: ping [-DdEefLnqRv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-V rtable] [-w maxwait] host patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime to live exceededFrag reassembly time exceededTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d --- %s ping statistics --- %lld packets transmitted, %lld packets received, %lld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms clock_gettime(CLOCK_MONOTONIC)invalid peernamepacket too short (%d bytes) from %ssignature mismatch!%d bytes from %s: icmp_seq=%u ttl=%d time=%.3f ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xping: sendtoping: wrote %s %d chars, ret=%d setresuidnumber of packets to transmit is %s: %sillegal timing interval %s%s: only root may use interval < 1stoo small interval, raised to 0.01preload value is %s: %spacket size is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sDEI:LRS:c:defi:l:np:qs:T:t:V:vw:unknown host: %ssize of sockaddr mismatchbind-f and -i options are incompatibleNo audible output for flood pings-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %d bytes (default %d)PING %s (%s): %d data bytes PING %s: %d data bytes stdio inetstdio inet dnsrecvmsgmakeentrylinkupfileerroriblockckinodemainpass2pass2checkpass5setup=\H =,=8=@=H=X=`=h=3p=x= ===<<===returning to single-user after filesystem check out of memory NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREFDIRLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu NAME=%s %s=%s DIRECTORY CORRUPTEDwrong type to dirscan %d lost+found%d %s I=%lluBAD STATE %d TO BLKERR cannot find inode %llu bad inode number %llu to nextinode Cannot allocate space for inode buffer bad inode number %llu to ginode blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d LARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE I=%llu OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s cannot increase directory list PARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)-%c flag requires a %s usage: %s [-dfnpy] [-b block#] [-m mode] filesystem Alternate super block location: %d bad mode to -m: %o ** lost+found creation mode %o b:dfm:npystarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%d files, %d used, %d free %d files missing %d blocks missing The following duplicate blocks remain: %d,The following zero link count inodes remain: %llu, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluuDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluINODE I=%llu HAS DTIME=%12.12s %4.4s (CORRECTED)bad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%d should be %d)UNKNOWN FILE TYPE I=%lluROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%llu ZERO LENGTHBAD/DUP%u: %2x summary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dblk_bitmap:bbmap:BLK(S) MISSING IN BIT MAPS #%dino_bitmap:ibmap:INODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADstrdup failedrealloc failedmalloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat rootCan't stat %s %s is not a character device %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: CANNOT READ DISKLABEL %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) %s: BLOCK SIZE DETERMINED TO BE ZERO BAD SUPER BLOCK: %s MAGIC NUMBER WRONGBAD LOG_BSIZEBAD BLOCKS PER GROUPcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x INCOMPATIBLE FEATURE BITS IN SUPER BLOCKsuperblock mismatchesoffset %ld, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATECan't stat %s: %s %s is not a character deviceCan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).USING ALTERNATE SUPERBLOCK AT %d state = %d ** F%sile system is clean; not checking ** File system is already clean IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULTWRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead bad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %dProgram terminated WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %lld (%lld), %lld,PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK UPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ:deadlocked buffer pool %6d %6s usage: %s [-benstuv] [file ...] benstuvremoveafaddafsetifxflagssetifwpasetifflagsgetifgroupssetifchangetifparentsetifparentinit_current_mediasetifnwidsetifbssidin6_getaddrsettrunkprotounsettrunkportsettrunkportunsetvlandevsetvlantagvlan_statusieee80211_listchansin_getaddrtrunk_statussetvlandevsetifwpagroupciphersetifwpacipherssetifwpaakmssetifwpaprotosieee80211_listnodesieee80211_statusstatusunsetifgroupsetifgroupsetifwpakeysetifnwkeyin6_aliasin_statussetgroupattribsprintgroupattribsprintgroupcwcccccyyyZ4tPwPw8x8xbb4 (4<T?@ABCDEFG(H4I@JLKXLdMpN|OPQRSTUVWXYZ [\$]0^<_HTX`dpx      @  ,4<DPT\dlx G35wL (L (0<DLTrandommalformed link-level addressSIOCSIFLLADDRSIOCDIFPARENTSIOCDVNETIDSIOCIFAFDETACHSIOCIFAFATTACHSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]SIOCG80211WPAPARMSSIOCS80211WPAPARMSSIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROYmedia mode %smediaopt instance %lld"%.*s"0xSIOCGIFGROUPgetifgroups groups:usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELprefix %s: %sparent: name too long parent: %s parent: parent too longSIOCSIFPARENTvnetid %s: %sSIOCSVNETIDSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sonly one `mode' command may be issuedllprio %s: %sSIOCSIFLLPRIOmtu %s: %sSIOCSIFMTUinet6autoconf not allowed for this AFbad hexadecimal digitshexadecimal digits too longstrings too longSIOCS80211NWIDmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%xInvalid trunk protocol: %sSIOCSTRUNKSIOCSTRUNKDELPORTSIOCSTRUNKPORTSIOCGETVLANSIOCSETVLANvlan tag %s: %s vlan: %d parent interface: %s SIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%d: bad prefixlen trunk: trunkproto %s trunkdev %sstrdup trunk id: [(%04X,%s,%04X,%04X,%04X), (%04X,%s,%04X,%04X,%04X)] trunkport %s MASTERSTACKACTIVECOLLECTINGDISTRIBUTINGDISABLED supported trunk protocols: trunkproto %s trunk: trunkdev %s vnetid: name is too long vnetid: none vnetid: %u invalid vlan tag and device specificationinvalid %s %s: %s%s not allowed for the AFvltimepltimeunknown %s media mode: %sinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %spsk802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %snwid chan %u bssid %s lladdr %s %u%% %ddBm powersave HT-MCS%d %uM %uM HT ESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSD RADIO_MEASUREMENTDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACK,wpa2,wpa1,wep,802.1xCACHEBSSAUTHASSOCCOLLECT no permission to scanSIOCG80211ALLNODES none restore ieee80211: nwid chan %u bssid %s %u%% %ddBm nwkey persist%d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep)HIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTINET6_NOPRIVACYMPLSWOLAUTOCONF6 rdomain %d metric %lu mtu %lu lladdr %s %cllprio %d status: %s %s: no media types? media: supported media: tunnel: inet%s %s -> %s:%u ttl %dunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKpersist:SIOCS80211NWKEY: too many keys.0x%sInvalid WEP key lengthSIOCS80211NWKEYinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCIFCREATEinvalid carp demotion: %scarpdemoteSIOCSIFGATTRSIOCGIFGATTR carp demote count %d%s: no such interface SIOCGIFGMEMBprintgroupinterface name '%s' too longdestroy'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakey-chanbroadcastvlanvlandev-vlandevgroup-groupautoconf-autoconftrunkport-trunkporttrunkprotoanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacypowersavepriorityrtlabelnwflagrdomain-inet-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaopt-modeinstanceinstlladdrllprioinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72HT-MCS0HT-MCS1HT-MCS2HT-MCS3HT-MCS4HT-MCS5HT-MCS6HT-MCS7HT-MCS8HT-MCS9HT-MCS10HT-MCS11HT-MCS12HT-MCS13HT-MCS14HT-MCS15HT-MCS16HT-MCS17HT-MCS18HT-MCS19HT-MCS20HT-MCS21HT-MCS22HT-MCS23HT-MCS24HT-MCS25HT-MCS26HT-MCS27HT-MCS28HT-MCS29HT-MCS30HT-MCS31HT-MCS32HT-MCS33HT-MCS34HT-MCS35HT-MCS36HT-MCS37HT-MCS38HT-MCS39HT-MCS40HT-MCS41HT-MCS42HT-MCS43HT-MCS44HT-MCS45HT-MCS46HT-MCS47HT-MCS48HT-MCS49HT-MCS50HT-MCS51HT-MCS52HT-MCS53HT-MCS54HT-MCS55HT-MCS56HT-MCS57HT-MCS58HT-MCS59HT-MCS60HT-MCS61HT-MCS62HT-MCS63HT-MCS64HT-MCS65HT-MCS66HT-MCS67HT-MCS68HT-MCS69HT-MCS70HT-MCS71HT-MCS72HT-MCS73HT-MCS74HT-MCS75HT-MCS76t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfh11nmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorhdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupactivekeepalive downroundrobinfailoverlacploadbalancedefaultusegroupwep40tkipccmpwep104displayprinttimeprintlong %s: %s: %s: directory causes a cyclefts_readCOLUMNSstdio rpath getpw1ACFHLRSTacdfghiklmnopqrstux%*llu %*lld total %llu %b %e %H:%M:%S %Y%s %*u %-*s %-*s %3d, %3d %*s%*lld %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] usage: sysctl [-n] name %s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufoundpr_iphpr_icmphsummarypr_rthdrpr_packpingermainusage: ping6 [-dEefHLmnqv] [-c count] [-h hoplimit] [-I sourceaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-V rtable] [-w maxwait] host Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPUnknown Header(%d) ...No Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sBad ICMP type: %d--- %s ping6 statistics --- +%lld duplicates, %.1lf%% packet losspath MTU for %s is notified. (ignored) nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: failed to get receiving hop limitfailed to get receiving packet informationsignature missing!%d bytes from %s, icmp_seq=%u hlim=%d dst=%s(DUP!)extra (%d bytes %s)sendmsgping6: wrote %s %d chars, ret=%d hoplimit is %s: %sc:dEefHh:I:i:Ll:mNnp:qS:s:V:vw:host %s: %shost resolves to multiple addressesgetaddrinfo failedinvalid source address: %sinvalid source addresssetsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionssetsockopt IP6_MULTICAST_LOOPUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memoryUDP socketUDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)setsockopt(SO_RTABLE)UDP connectgetsocknamesetsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6 %s (%s --> %s): %d data bytes new path MTU (%d) is notified mainusage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatUTCcannot unsetenv TZ-t %s: %sad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Yspecified date is outside allowed rangeCould not get local time of dayadjtime???date set by %sstdio rpath wpathtoo many argumentsconversion errorusage: %s ioctl SMODEWSMOUSEIO_SCALIBCOORDSmmap/dev/ttyC0open /dev/ttyC0/dev/wsmouseopen /dev/wsmouseWSMOUSEIO_GCALIBCOORDSmouse.scale=%d,%d,%d,%d,%d,%d,%d mainld, @ @$8DPusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT RPCbad MNT RPCcan't access %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportnfsv2acmainUSER_print_diskUSER_editgetuint64ask_pidask_numunused 00000000-0000-0000-0000-000000000000DOS FAT-12 ebd0a0a2-b9e5-4433-87c0-68b6b72699c7XENIX / XENIX /usr DOS FAT-16 ebd0a0a2-b9e5-4433-87c0-68b6b72699c7Extended DOSDOS > 32MB ebd0a0a2-b9e5-4433-87c0-68b6b72699c7NTFS ebd0a0a2-b9e5-4433-87c0-68b6b72699c7AIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32ebd0a0a2-b9e5-4433-87c0-68b6b72699c7 Win95 FAT32Lebd0a0a2-b9e5-4433-87c0-68b6b72699c7DOS FAT-16 ebd0a0a2-b9e5-4433-87c0-68b6b72699c7Extended LBAOPUS OS/2 hidden ebd0a0a2-b9e5-4433-87c0-68b6b72699c7Compaq Diag.OS/2 hidden ebd0a0a2-b9e5-4433-87c0-68b6b72699c7OS/2 hidden ebd0a0a2-b9e5-4433-87c0-68b6b72699c7OS/2 hidden ebd0a0a2-b9e5-4433-87c0-68b6b72699c7AST swap Willowtech ThinkPad Recebd0a0a2-b9e5-4433-87c0-68b6b72699c7$NEC DOS 'Win Recoveryde94bba4-06d1-4d40-a16a-bfd50179d6ac Willowsoft 8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRaf9b60a0-1431-4f62-bc68-3311714a69adCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX ChromeKernelfe3a2a5d-4f32-41a7-b725-accc3285a309Minix (old) Minix (new) Linux swap 0657fd6d-a4ab-43c4-84e5-0933c84b4f4fLinux files*0fc63daf-8483-4772-8e79-3d69d8477de4OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM e6d6d379-f507-44c2-a23c-238f2a3df928Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD 516e7cb4-6ecf-11d6-8ff8-00022d09712bOpenBSD 824cc7a0-36a8-11e3-890a-952519ad3f61NEXTSTEP MacOS X 55465300-0000-11aa-aa11-00306543ecacNetBSD 516e7cb4-6ecf-11d6-8ff8-00022d09712bMacOS X boot426f6f74-0000-11aa-aa11-00306543ecacMacOS X HFS+48465300-0000-11aa-aa11-00306543ecacBSDI filesy*BSDI swap Solaris 6a85cf4d-1dd2-11b2-99a6-080020736631CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 42465331-3ba3-10f1-802a-4861696b7521EFI GPT EFI Sys c12a7328-f81f-11d2-ba4b-00a0c93ec93bSpeedStor DOS 3.3+ SecSpeedStor Xenix BBT XhelpXwriteXreinit[[oƶ~W ۅK%:pl1vb)BQ#5EҎϷ&:q:.Iq֬m\^s| [~&k^j=CWZ|t:7\U?[\Caă<fa&,r8ӱ-7iLպӹw_V~p{-Cq^x܊K\"Ofb&b6T$SLTY ɏq8ŢBOEJʊ) <63Mk~TD{of‚fڢ=*-:Kq A`XΣzF+/,J?J4\$9@:&Yk9̓y%mlZKTcŖ4<ë۩xϿpM7Sq)O/ `H]LŶd, iyl{$dFNez|V[B$Bsz2HC؎BmXZ\R.8\".Q*ؑsp1Jl ΙyiEQ#uNgN[FU>#lv) P@8| XguJIõp,4녗30!֕;/]IxV.ښP>Y$؇'(KޖZ0eUə8_t* *}H0L9uupu}Z34zF_j,u.3 $tL=wY](( =wYq{]=k]fݡM?GBAP~UPQ2Y,dK8g.өjKUV鿾"ULkvzc"s(mȆEq"k&P~}NH)} “"t\"Z ?s)o8$0Zܡ5|kuws3% +Å/6.[AIj|Hr,;Ԃ._|p^I4^iBMd̩\eDVt+:TKiU1PsQƮG~Tu IHnD(N$8z Pi5Tܦ}H6H2R)MK AI*=l+IIʉlǐ])q:,ihh]zB6Tu]HsG .UO8N Rnd*j7DQ-F05r%a +wشxAދ_/ćkq}!.;NI?.$AS|G.f15IJնSFa׋"ym~,§n$GeXa/vra=˼\vB;?X~ a4&GMQnOq}9?;;=< (d!5~|? 򭼓HM%T5zOW`18:>'7_a|6oZz[^ZpdcR(wvr6 AE]\KlbkۜjV8 6;{Z%\ΣSjLAk Ͳ|Ῥ=r/z 5O;<7 Llgd"|_q©u vje53x)HT(ɨ1)F {H::@Fy;I㜗\Q3"}aV+A &=A:7B>jֽ]`&108¢4ٖ a5YģSn}-WR81-W&ZME6C~Jp.o|7 yDNl8p?jw٦CM-$2ҫ7t22(@TB٨'+"yw2p OgWĿ^)g_#En7ϙ2Ujse"_ /_{+g|Ǚ YZJήcoWmJ~ǟ/믵GNX\/Q^ vwqPƕ@=_tKgTp@>.KQև&HN*Pg*eV|"9K&g$yK[q`~Q2VOm\ƺhݾ(׏RA/>Hywqw)tOyω˻_sd^hpΎ;ef[fGV9*I(KUG~1ߛ`%NKϐŏȉ[;A:w~!zvl+,0)dQ5M)ʅag`,A?q\X?蝠O̬?Y? \I6Ţ/?@or^i|<zr'`u ?:=N`t|_?Z!Q++(7+[%G+Ţ?0G8;ri\y‹_BovS=vu2ъ~s!.n{F\KϏ++(qkT2t9USˁN)}fvm$E#S í<*+i1,T+ggc7Ĝ>%dtkg ?a!cqQ9~9h)@zǝ_֋) d2mg cg& J#ɃUOiaU \ē=' 4xi v[_5 NuD94Yׁ>p, `zxHo kmx<wMP479I1__⾠- UbI?bc*\ o(Bv՜%FX%Ii6S*kfn")h@ucT)S_ȳ ?OȞmn^:ﷶUGzmo, qWDx=dW;LǠ6 %?ausage: %s [-egvy] [-i|-u] [-b #] [-c # -h # -s #] [-f mbrfile] [-l # ] disk -b: specify special boot partition block count; requires -i -chs: specify disk geometry; all three must be specified -e: interactively edit MBR or GPT -f: specify non-standard MBR template -g: initialize disk with GPT; requires -i -i: initialize disk with MBR unless -g is also specified -l: specify LBA block count; cannot be used with -chs -u: update MBR code; preserve partition table -v: print the MBR, the Primary GPT and the Secondary GPT -y: do not ask questions `disk' may be of the forms: sd0 or /dev/rsd0c. Cylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].Block argument %s [64..%u].iegpuvf:c:h:s:l:b:ystdio rpath wpath disklabel proc execCan't read sector 0!disk too large (%llu sectors). size truncated.using builtin MBRUnable to read MBR from '%s'Unable to read complete MBR from '%s'Do you wish to write new GPT?Do you wish to write new MBR and partition table?Do you wish to write new MBR?Primary GPT: Not FoundSecondary GPT: MBR:Enter 'help' for informationfdisk:%c%d> Invalid command '%s'. Try 'help'. Aborting changes to current MBR.helpCommand help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statseditEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tablewriteWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes%s [n] %s [%llu - %llu]: [%llu] %s is out of range: %c%s%c %s is invalid: %c%s%c Partition id ('0' to disable) [01 - FF]: [%X] (? for help) '%s' is not a valid number. '%x' is out of range. %s [%d - %d]: [%d] %s is %s: %s. BytesSectorsKilobytesMegabytesGigabytesTerabytesDisk: %s geometry: %d/%d/%d [%.0f %d-byte geometry: DIOCGPDINFOCan't get disk geometry, please use [-chs] or [-l]to specify.Offset: %lld Signature: 0x%X Start of partition #%d after end! Starting Ending LBA Info: #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12llu:%12.0f%s] %s Warning CHS values out of bounds only saving LBA valuesChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s partition number is %s: %s. flag value is %s: %s. Partition %d flag value set to 0x%llx. Partition %d marked active. Machine code updated.partition number is invalid:partition number is %s: %s %d same partition as %d, doing nothing. MBRGPT %s %s MBR contains more than one OpenBSD partition!Write MBR anyway?Writing MBR at offset %lld. error writing MBRWriting GPT.error writing GPTPartition %d is not an extended partition. Loop to offset 0! Not selected.Selected extended partition %d New MBR at offset %lld. could not create guid for partitionPartition %d is disabled. Partition offsetPartition sizePartition namepartition name must be < %d characters Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorChange disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsgptmbrUnrecognized modifier '%s' Use 'write' to update disk.OpenBSD Area%c%3d: %-36s [%12lld: %12.0f%s] %-36s %-36s #: type [ start: size ] guid name------------------------------------------------------------------------Disk: %s Usable LBA: %llu to %llu [%.0f GUID: bin_file0123456789A:B:CEFGHILRUVabce:f:hilnoqrsuvwxy%%%A%BC@D%E%F%G%H%UV%a&bc &e4'f&h &i,&L@&lT&n`&qh&qp&r|&s&v&w&x&uinvalid file type(standard input)(fd %d)usage: %s [-abcEFGHhIiLlnoqRsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] ^\((%s[[:<:]]%s%.*s%s[[:>:]]%scontext out of rangecontext %sgrep version %u.%u binarywithout-matchtextUnknown binary-files optionwarning: recursive search of stdinCan't use small fgrep with -wbinary-filesline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetsreallocarrayreallocLine is too big to process--Binary file %s matches umountfsusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s afh:t:vmainldp@usage: mount_msdos [-9ls] [-g gid] [-m mask] [-o options] [-u uid] special node invalid file mode: %suser is %s: %sgroup is %s: %ssl9u:g:m:o:stat %snot an MSDOS filesystemcheckfsfsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't set resource limit to max data sizeCan't get resource limit for data size-b %s-l %s: %sInvalid option stringusage: %s [-dfNnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] b:dfl:nNpT:t:vy%s: unknown special file or file system.Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sexpandinittermsearchcommandmain5MS7) tgetentusage: %s [-dfln] [+linenum | +/pattern] name1 name2 ... %s: unknown option "-%c" out of memory! No previous command to substitute fortcgetpgrpTERMlicohcxnxssosgulospccmcdbcti ...Skipping back ...Skipping %sto file %s --More--(Next file: %s)(%d%%)[Press space to continue, 'q' to quit.][Use q or Q to quit]Line too longNo previous regular expression...skipping Pattern not found Pattern not found "%s" line %lld[Not a file] line %lld...back %d page...skipping %d line ***Back*** [Press 'h' for instructions.] ******** %s: Not a text file ******** *** %s: directory *** stdio rpath ttyMORE:::::::::::::::::::::::::::: Most commands optionally preceded by integer argument k. Defaults in brackets. Star (*) indicates argument becomes new default. ------------------------------------------------------------------------------- Display next k lines of text [current screen size] z Display next k lines of text [current screen size]* Display next k lines of text [1]* d or ctrl-D Scroll k lines [current scroll size, initially 11]* q or Q or Exit from more s Skip forward k lines of text [1] f Skip forward k screenfuls of text [1] b or ctrl-B Skip backwards k screenfuls of text [1] ' Go to place where previous search started = Display current line number / Search for kth occurrence of regular expression [1] n Search for kth occurrence of last r.e [1] ! or :! Execute in a subshell v Start up /usr/ucb/vi at current line ctrl-L Redraw screen :n Go to kth next file [1] :p Go to kth previous file [1] :f Display current file name and line number . Repeat previous command ------------------------------------------------------------------------------- TERMCAP/usr/share/misc/termcapTERMPATHHOME.termcap /usr/share/misc/termcapOOPSreadb64filemainreduce_add_sub, )c]!!\cXcrypto_scalarmult_curve25519crypto_sign_ed25519_opencrypto_sign_ed25519_ref_double_scalarmult_vartime%`-V%`,i\1Sn6i!XfffffffffffffffffffffffffffffffmRQw }dNfev_gY&V0V$xYMuAAM pywy@so+lRJ'x/C/=M+ O$+crypto_hash_sha512malloc %zuuntrusted comment: invalid comment in %s; must start with '%s'comment too longmissing new line after base64 in %sinvalid base64 encoding in %sEdunsupported file %sverification failed: checked against wrong keysignature verification failedSignature Verifieddup failedcan't open %s for %snot a valid file: %smsg too large in %sread from %susage: %1$s -V [-eq] [-x sigfile] -p pubkey -m message verify with /etc/signify//../untrusted path %smust specify pubkeystdio rpath wpath cpath ttyCGSVc:em:np:qs:x:setvbufmust specify sigfile with - message%s.sigpath too longmust specify messagewrite to %susage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p stdio dpathmkfifoinvalid file mode '%s'forbidden mode: %om:invalid device type '%s'invalid major number '%s'major number too large: '%s'invalid minor number '%s'minor number too large: '%s'major or minor number too large (%lu %lu)write_old_entrycleanupdb_storemain-1%s:*:%s:%s:%s:%s:%s usage: pwd_mkdb [-c] [-p | -s] [-d directory] [-u username] file %s.orig/etc/spwd.db%s.tmp/etc/pwd.dbat line #%dline %d: superuser override in YP inclusionline %d: wheel override in YP inclusionwrite oldcan't find user in master.passwdbasedir too longusername too longcd:psu:v_shadowcannot find `%s' in the group database, aborting%s must be specified as an absolute path%s: unable to set group to %s%s: unable to make group readablestdio rpath wpath cpath getpw fattr flock__YP!close edpclose dpclose oldfclose/etc/passwd/etc/master.passwdsodumpprint_rtmsgmonitorinet6_makenetandmaskgetaddrG35wnetname6routenamep_flagsp_rtentry0123456789abcdefUGHRBD M@dCmLS1@2 3cPT l@bconnectedstaticospfis-isbgpbad label: %s is %sinvalid table id: %slabel too longprefixlen is not supported with af %dprefixlen %s is %s%s: link %s; %s: inet %s; %s: inet6 %s; priority is %s: %s sockaddrs: locks: inits: set_metric mtu: %s is %sset_metric expire: %s is %sking bula sez: set_metric with invalid key route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8lld%c sockaddrs: [rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture, priority %d, table %u, ifidx %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8lld%cso_dstso_gateso_maskso_ifpso_ifaso_labelso_srcread from routing socketroute-sysctl-estimateactual retrieval of interface tablestdio rpath dnsgot message of size %d on %s128internal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtablemust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplsnetmask missingwriting to routing socket%s %s %s: gateway %sentry in userouting table overflownot in tableno such interface %sactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen %-20.20s donednqtT:vrouting table %dsetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)addblackholechangecloningdstexpiregatewaygethopcountifaifpjumbolinkllinfolockrestmpathmplslabelnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl of routing tableRouting tablesurl_getauto_fetchExtra `@' characters in usernames and passwords should be encoded as %%40dataconngetreplyabort_remoteinitconnhookupmaingetitmgetptransferprogressmeterfileindirremglob2ftp_login KMGTPftp://http://file::/Can't allocate memory for URL decodingerror in base64 encoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy host.Can't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... r+Requesting %sCan't allocate memory for URL encoding%%%02x (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s Host: %s %s%s GET %s HTTP/1.0 Host: %s %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]:%sWriting HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget file fetch aborted. http fetch aborted. Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uBad family! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: %1$s [-o output] ftp://[user:password@]host[:port]/file[/] ... %1$s [-o output] http://host[:port]/file ... %1$s [-o output] file:file ... %1$s [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dD:Eegik:Mmno:pP:r:S:s:tU:vVUser-Agent: OpenBSD ftpstdio rpath dns tty inet fattrstdio rpath wpath cpath dns tty inet fattrnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. asciiimage%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundftpXXXXXXXXXXunable to create temporary file: %sLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. mainusage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidopenSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): mainldp@,f,usage: mount_ffs [-o options] special node filesystem must be mounted read-only; you may need to run fsckreloadapply_ignore_listget_ifnamerewrite_option_dbpacket_to_leasestate_panicsend_request.@'state_rebootroutehandlermainparse_option_declparse_client_statementget_rdomaininterface_statusinterface_link_forceuppackethandlersend_packetif_register_bpf5pretty_print_classless_routespretty_print_option"(`JdĊԊ' | & 4  #(J$0|8@HX ` l(t!resolv_conf_prioritypriv_add_addresspriv_delete_addresspriv_set_interface_mtupriv_add_routepriv_flush_routes= 0DP`l|,Ȑ=Ԑ  ,0,H<X|Mp, =đ ܑ  =,, D|MX p<|M ȒԒ<0@Pd=||M<<=Г,|M,|M@Xp|̔$0Dlxؕ̕ $0<HT`lx̖ؖ ,8DP\htėЗܗ $0<HT`lxȘԘ ,8DP\htșԙ(4@LXdp|ĚКܚ $0<HT`lx̛؛ ,8DP\htȜԜ(4@LXdp|ԝ hOparse_dateCouldn't open '%s': %sCouldn't write contents to '%s': %sShort contents write to '%s' (%zd vs %zu)fchown(fd, %d, %d) of '%s' failed (%s)fchmod(fd, 0x%x) of '%s' failed (%s)short IMSG_WRITE_OPTION_DBwarning: hostname %s contains an underscore which violates RFC 952short IMSG_WRITE_RESOLV_CONF/etc/resolv.confwrite_option_db: imsg_compose: %swrite_option_dbwrite_resolv_conf: imsg_compose: %swrite_resolv_confInvalid option name: '%s'Unable to clone leaseUnable to apply defaultsCannot copy domain name listNo memory to decode domain searchsearch %s no memory for domainnamenameserver %s no memory for nameserver# Generated by %s dhclient no memory for courtesy lineno memory for resolv.conf contentsegresssocket errorno interface in group egress foundioctl SIOCGIFGMEMB: %sget_ifnametoo many interfaces in group egressInterface name too long: %sInterface name too longdaemoncannot forkchdir("/")%s [priv]no memory for priv_ibufpoll error: %simsg_read(priv_ibuf): %sUnable to truncate '%s': %s%s; restarting.RESTART FAILED: '%s': %s%s; exiting bootp; %s { %s interface "%s"; fixed-address %s; next-server %s; filename server-name ssid option %s %s; renew %w %Y/%m/%d %T UTC; rebind %w %Y/%m/%d %T UTC; expire %w %Y/%m/%d %T UTC; } offeredcannot fit offered lease into option dbcannot make offered lease into stringeffectivecannot fit effective lease into option dbcannot make effective lease into stringlease file not opencannot make lease into stringoptions do not fit in DHCPDECLINE packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDISCOVER packet.DHCPDECLINE on %saddressinuse: getifaddrs: %sdhcpoffer: no memory to create lease.option-dhcpoffer: unknown option %dBogus data for option %sMissing required parameter %s%s already configured on %sdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.bound to %s -- renewal in %lld seconds.mtu size %u < 68: ignoredNo acceptable DHCPOFFERS received.Trying static lease %sTrying recorded lease %sNo working leases in persistent database - sleeping.DHCPDISCOVER on %s - interval %llddhclient cannot be used on %sDHCPREQUEST on %s to %sUnsatisfactory %susage: %s [-d | -q] [-u] [-c file] [-i options] [-L file] [-l file] interface %s: no link .... got link sleeping No memory for rtmmsgroute socket buffer overflow%s, not %s, added to %s%s added to %sActive address (%s) deleted; exiting%s, not %s, deleted from %s%s deleted from %s%s downLLADDR changed; restarting%s departuredno memory for errmsg'%s' is not a regular filec:di:l:L:quifi calloc%s: no such interfaceCan't create socket to get ssidsetting routing table to %u: '%s'socketpair: %sno memory for unpriv_ibufconfig callocclient calloc/dev/nullcannot open %s: %s_dhcpno such user: _dhcp%s.%s/var/db/dhclient.leasesasprintf/etc/resolv.conf.tailCannot open /etc/resolv.conf.tail: %sCannot stat /etc/resolv.conf.tail: %sno memory for resolv.conf.tail contents: %sCouldn't read resolv.conf.tail: %sGot no data from resolv.conf.tailShort read of resolv.conf.tailcan't open and lock %s: %scan't open %s: %ssocket(PF_ROUTE, SOCK_RAW): %ssetsockopt(ROUTE_MSGFILTER): %ssetsockopt(ROUTE_TABLEFILTER): %s/var/empty/setresgidsetgroupsstdio inet dns routestdio inet dns route proc/etc/dhclient.confno memory for reject address!expecting option name.too many options.expecting hex octet.string constant too long.expecting string or hexadecimal dataexpecting ':'.expecting identifier after option keyword.unknown option name.expecting string.option data buffer overflowexpecting signed 32-bit integer.expecting unsigned 32-bit integer.expecting unsigned 16-bit integer.expecting unsigned 8-bit integer.expecting identifier.truefalseoffexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.expecting interface name (in quotes).wrong interface name.expecting lease declaration.expecting left brace.no memory for lease.unterminated lease declaration.Obsolete client identifier (%s) in recorded leaseexpecting a statement.unterminated interface declaration.Corrupt lease file - possible data loss!get_rdomain socket: %sCan't create socketioctl(SIOCGIFFLAGS) on %s: %sinterface_link_forceup: SIOCGIFFLAGS failed (%s)interface_link_forceup: SIOCSIFFLAGS DOWN failed (%s)interface_link_forceup: SIOCSIFFLAGS UP failed (%s)%s receive_packet failed: %s%s too many receive_packet failures; exitinggetifaddrs failedpoll: %sdispatch%s; restartingsend_packet: %ssocket(SOCK_RAW): %ssetsockopt(IP_HDRINCL): %ssetsockopt(SO_RTABLE): %s/dev/bpf0Can't open bpf: %sCan't attach interface %s to /dev/bpf0: %sCan't get BPF version: %sKernel BPF version out of range - recompile dhclient!Can't set immediate mode on bpf device: %sCan't set filter-drop mode on bpf device: %sCan't get bpf buffer length: %sCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %sCan't install write filter program: %sCannot lock bpfcScoption %s (%d) larger than buffer.option %s has no length field.Can't allocate storage for option %s.Can't expand storage for option %s.DHCPACKDHCPOFFERDHCPNACKBOOTREPLY%s from %s (%s)no memory for info stringTruncated pointer in DHCP Domain Search option.Invalid forward pointer in DHCP Domain Search option compression.Truncated label in DHCP Domain Search option.Domain search list too long.Truncated DHCP Domain Search option.Can't allocate storage for expanded domain-search %s%s/%u %s"'$`\\%cpretty_print_option: bad code %d%s: Excess information in format string: %s%s: no size indicator before A in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: expecting only %d bytes: got %d%s: expecting %d bytes: got %d%huUnexpected format code %ceof in string constantstring constant too longtoken larger than internal bufferappendbackoff-cutoffbootpdenyethernetfixed-addresshardwareignoreinitial-intervallink-timeoutmediumnext-serverprependrebindrenewrequireretryselect-timeoutsendserver-namessidsupersedetimeout%s line %d: %s%*c^ %s: msgbuf_write: %sRTM_DELETE write: %sshort RTM_DELETE write (%zd) DHCLIENT DHCLIENT %dcreating route label: %screating route label: label too long (%d vs %zu)default route socket: %sRTM_GET of default route: %sget default route read: %sno data from default route readdefault route read rtm: %ssendhup: imsg_compose: %ssendhupadd_address: imsg_compose: %sadd_addressset_interface_mtu: imsg_compose: %sset_interface_mtudelete_address: imsg_compose: %sdelete_addressadd_route: imsg_compose: %sadd_routeflush_routes: imsg_compose: %sflush_routessocket open failed: %sSIOCAIFADDR failed (%s): %sSIOCDIFADDR failed (%s): %sSIOCSIFMTU failed (%d): %sdelete_addresses getifaddrs: %sRouting Socket open failed: %sfailed to add route (%s/%s via %s/%s): %ssysctl size of routes:routes buf realloc:sysctl retrieval of routes:route cleanup failed - %s %s (msize=%zu)opening socket to flush routes: %s%d bad IP checksums seen in %d packets%d udp packets in %d too long - dropped%d bad udp checksums in %d packetspadsubnet-masktime-offsetroutersIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81relay-agent-informationoption-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118domain-searchoption-120classless-static-routesCIAoption-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143tftp-config-fileoption-145option-146option-147option-148option-149voip-configuration-serveroption-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248classless-ms-static-routesoption-250option-251autoproxy-scriptoption-253option-254option-endexpecting semicolon.time string too longinvalid time string%w %Y/%m/%d %T UTC%w %Y/%m/%d %T%u %Y/%m/%d %Tunparseable time stringtime could not be representedexpecting unsigned 32-bit decimal value.expecting CIDR subnet.expecting '/'.Expecting CIDR prefix length.expecting 'ethernet'.expecting '.'.expecting decimal octet.filename must be a stringno memory for string %s.dispatch_imsg: imsg_get failure: %sbad IMSG_DELETE_ADDRESSbad IMSG_ADD_ADDRESSbad IMSG_FLUSH_ROUTESbad IMSG_ADD_ROUTEbad IMSG_SET_INTERFACE_MTUbad IMSG_HUPreceived unknown message, code %uhandle_hupusage: %s [-] [-s] [-p string] [file] get_compiled_patterncannot close temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot seek temp filecannot write temp filecannot read temp fileunexpected end-of-file& no previous commandinvalid pattern delimiter%d \  \abfnrtv\cannot read stdincannot open output filecannot write filecannot close output filecannot open input filecannot read input filenewline inserted newline appended cannot close input fileed.hup/ed.hupno current filenameinvalid filenamefilename too longnumber out of rangeno matchinvalid mark characterinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailablestdio rpath wpath cpath proc exec ttycrypt unavailable ? p:sx ? interrupt? warning: file modifiedscript, line %d: %s no previous patternunbalanced brackets ([])trailing backslash (\)infinite substitution loopnothing to undocopy_link%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).HLPRfiprstdio rpath wpath cpath fattrthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too longusage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory update times: %schown: %schmod: %schflags: %sunlink: %smknod: %smkfifo: %sreadlink: %ssymlink: %soverwrite %s? dodecompressmainȶض$l(n8<gz_open      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs (4HXVusage: %s [-123456789cdf%sh%slNnOqrt%sv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfh%slNnqrt%sv] [-o filename] [file ...] usage: %s [-f%shqr] [file ...] OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) .-_tgztazfchown: %sfchmod: %sfchflags: %sfutimens: %scompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errorstdio rpath wpath cpath fattr chownzcatzipunknown program nameGZIPoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gz123456789ab:cdfhLlNnOo:qrS:tVvcfhLlNno:qrtVvfhqrgzz1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionowner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.stdio rpath fattrinvalid flags: %sinvalid flag: %susage: %s [-g group,group,...] [-u user] newroot [command] g:u:no such user `%s'unable to get login class for `%s'too many supplementary groups providedno such group `%s'setusercontextsetuidmakeentrylinkupfileerrordirscaniblockckinodecheckfilesyspass2pass2checkpass5setup=\H =,=8=@=H=X=`=h=3p=x= ===<<=== @ catchinforeturning to single-user after filesystem check ?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@%lld %s I=%llubad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listbad inode number %llu to nextinode %llu cannot alloc %zu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem conversion levelcannot do level %d conversion dfpnNyYb:c:m:EXCESSIVE DUP BLKS I=%llucannot alloc %zu bytes for inoinfobad direct addr: %lld bad indirect addr: %lld INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)too many inodes %llu, or out of memory 08`EW<  EW6*`[~ [~EW`@@<@TU }Wdb}WddAHW>\'PWLPWL` C:AIWݨ IWݨ IW.ܦa CIW:9IW:9IWVb l[AIWL&SW5mSW5mc aAIW}1IWOj6IW6s7d mгAIWx4IWx4IW3B6e  qAJW|JW|JWf q0Ga }1eQ2 31@j>QS&5F]xd8wBSW(yn->*Z)Jx\QHtzbXĎ-P/fC,¤}MXH\qU/}0{(*')iRa8PRlt4'{Ur{a/($z0oE8,՗dEPeh tW]W5Լ\0cW3!\*L(BTp=9Suxi 7L :YZQQuԦ$cOoiaf<>gp Q5)0Po[x "wg2R77Pij(ʷsXN(W6joQi,j$wq" Tl;eY!œ Q%XT'SieU FQ\pWdnYX\;s>7y+NCJG6Z$#S|}S asO|lR;B@ . ..arch- catchmod-chgrp- cpdate- dd df edhostname  ksh sh ln ls mtsha256sha512mkdir-eject- mv pax tar rmsleep-stty-sync-A ...B ...C . ..chrootpwd_mkdb ztsscale D . ..Ekeymapsmisce;E .D..F ...root:*:0:0:Charlie &:/root:/bin/ksh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source:/:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico _dhcp:*:77:77:DHCP programs:/var/empty:/sbin/nologin nobody:*:32767:32767:Unprivileged user for NFS:/nonexistent:/sbin/nologin phase 1, inode %llu/%lluphase 1b, inode %llu/%llu%s %s: LENGTH %zu NOT MULTIPLE of %d%s %s: LENGTH %zu NOT MULTIPLE OF %dphase 2, directory %d/%dphase 2, parent directory %d/%d (REMOVED)phase 3, directory %d/%ldphase 4, inode %llu/%lluDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %lld MARKED FREE ALLOCATED FRAG %lld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%d%s: NOT LABELED AS A BSD FILE SYSTEM (%s) NCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATEstdio rpath wpath getpw tty disklabelINFORMATION; SEE fsck_ffs(8).clean = %d UNDEFINED OPTIMIZATION IN SUPERBLOCKIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %zu bytes for blockmap cannot alloc %zu bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %llu out of rangeCANNOT %s: BLK %lldWRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCKf_single_user   delete %d: %sinsert %d: %ssession database close: %ssession database open: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %scan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't open %s: %mcan't get %s for controlling terminal: %mcannot disable lid suspendcan't exec %s for %s %s: %m/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartingautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modeinit: %s init: already running initial setsid() failed: %msetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsmainmkfsusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk labelcan't get physmeminsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s: not a character-special deviceempty partition name supplied%s: can't figure out file system partitionstdio disklabel tty%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: no default sector size%s: maximum file system size on the `%c' partition is %llu sectorswarning: changing optimization to space because minfree is less than %d%% setblock bad fs_frag %dclrblock bad fs_frag %disblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %llu out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d fragmentsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get rlimitwarning: fsck_ffs will need %lluMB; min(ulimit -dH,physmem) is %lluMBsuper-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d checkrm_overwriteusage: %s [-dfiPRr] file ... "/" may not be removed"." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %llu): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrstdio rpath wpath cpath getpwstdio rpath cpath getpwusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countbsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:pstdio rpath cpath fattrcompileflush_appends\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangewfile too longno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'-i may not be used with stdinrename()%s: %s %sin-place editing onlyworks for regular files%s/sedXXXXXXXXXX ..."usage: sed [-aEnru] [-i[extension]] command [file ...] sed [-aEnru] [-e command] [-f command_file] [-i[extension]] [file ...] Eae:f:i::nrupledge: %sstdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtv8 @ D` l P \ ` l t | \cl ̤        c_umask8@ << @ D L\ X d| l t@ |< @ ܳ  4 T  (  <  h  l 4-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$T?$\Ht\flcdslmndpx_modekb_addx_bindx_emacsx_search_hist@    H $ 4 @ X p     Tl s|    0 , H  $   (T, 4 DL X h+ th    d   4   ( < , @ H T*  d < |< |   $* X dbteste_isah++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():hist_initj_print*doppromptyylexIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }gmatchgetoptionsP a\ h cp X]|  e   i k l Xxm Cn f  b u   prxs h( v\ 0 8 D T d xdo_phys_pathshf_vfprintf$,4<@ H   4 P X`Id d{h}?lptx| %*/2]]<>!let||&&()str_val x|  5 5 *@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBafree: %p not present in area %punable to allocate memorylmmissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGbad signal `%s'usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %s: arguments must be jobs or process IDs%*d %*s %s%*d %*d %sjob control not enabled%%lpnzno argumentsadtdprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found L#R#UZ#fi#lprtuxonly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U exportreadonly%s[%d]pvpvV is a reserved wordexported is an %salias for alias %s= is an exported traced undefined (autoload from %s) function special is a%s shell builtin is a tracked %salias for not found%s is *GOK*Rnprsu,-n-p: %s-u: %s: %sLPcan't get current directory - %srestricted shell - can't cdPWDOLDPWDno home directory (HOME not set)no OLDPWDdon't know current directoryCDPATH%s: bad directory+alias+cd+command*=export+fc+getopts+jobs+killletpwd*=readonly=typeset+unaliaswhence+bg+fgunalias-tacan't suspend a login shelltime: -%s unknown optiontime: -%s requires an argument:p%s%*lld.%02ld%s%s%*lldm%02lld.%02lds%sreal real user sys user system fv%s is read only%s: cannot %s%s: can only %s %d level(s)%s: bad numbertrap -- bad signal %sprsu,ugorwx%#3.3o augo=+-rwxugoXsbad masknothing to shift*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift*=times*=trap+=wait+readtest+trueulimit+umask*=unsetsuspendmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operatorunexpected operator/operandinternal error: unknown opmissing ]-t-aunlimited unlimitedinvalid limit: %s-%c exceeds allowable limitbad -%c limit: %susage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s time(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)IFS!"#$&'()*:;<=>?[\]`{|};|&()`+@!fileglob: substitute errorFPATHLINES nothing to yank yank something firstduplicate binding for %sPOSIX%s = %s %s = '%s' cannot bind, not a ttyauto-insert%s: no such functioninvalid return code I-search: beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringkill-to-eolkill-regionlist-commandlist-filequoteyank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $(<) input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %sdbteste_error: %s (offset %d)shcomexec: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sPS4%s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %sbuiltin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :HISTFILE%s.%dno history (yet)%s: not in history%s: invalid rangehistory function called recursivelyhistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16%.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%sremove_job: job not found (%s)notifyj_async: job not startedj_async: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs j_waitj: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitforwaitlast: no last jobwaitlast: not startedjw:waitlastexchild: XPIPEI and no last_job - pid %dfork failedcannot fork - try againchildexchild: execute() returned[%d]jw:last procj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlj_suspend: tcsetpgrp() failed: %sj_suspend: setpgid() failed: %scheck_job: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_shell: %dUse `exit' to leave ksh include: %drshrkshrpdkshpdrkshstdio rpath wpath cpath fattr flock getpw proc exec ttySH_VERSIONPPIDUSER$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-xOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPautoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -slogin=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings %co %s%s: bad optionparse_args: `%c'allexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivekeywordloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallverbosevirawvi-show8vi-tabcompletevi-esccompletextracealnumalphablankcntrldigitgraphlowerpunctupperxdigitshf_flush: no fdshf_emptybuf: no fdshf_write: flags %xshf_write: nbytes %dshf_putchar: flags %xshf_putchar: no fd0123456789abcdef(null %s)shf_ungetc: flags %xshf_fillbuf: no fdshf_getchar: flags %xshf_getse: flags %xshf_read: flags %xshf_read: bsize %dshf_sopen: flags 0x%xshf_snprintf: buf %lx, bsize %dshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_fdopen: missing read/writeunexpectedunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s too many <<'s too many redirections for%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildo{}[[&&||;;((|&too many varssetexecsig: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIGwdscan: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %s%0*s%.*s%*s%.*s%s: subscript %ld out of range%s: is read onlysetstr: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOM-grabhist: bad history arrayy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --print_passwdmainblowfish,%spref too longunable to get login class `%s'localciphercan't generate hashusage: %s [-b rounds] [-c class] [-p | string] stdio rpath wpath ttyrounds is %s: %spb:c:Enter string: getpassderive_key_pkcsbio_diskinqbio_createflagsbio_parse_devlistbio_changepassbio_deleteraidbio_createraidbio_blinkbio_getvolbynamebio_alarmbio_inqstr2patrolbio_patrolstr2locatorbio_setblinkbio_setstatemainInvalid keyInvalid saltToo few rounds: %dinvalid passphrase filecan't stat passphrase filepassphrase file must be owned by rootpassphrase file has the wrong permissionscan't read passphrase fileinvalid passphrase lengthunable to read passphraseRe-type passphrase: Passphrases did not matchpbkdf2 failedinvalid KDF infoinvalid KDF hintKDF hint has invalid sizeunknown KDF type %dnumber of KDF rounds too low: %dDIOCINQ%s: <%s, %s, %s>, serial %s invalid flags listinvalid flag %sinvalid device listcould not open %scould not stat %stoo many devices on device listduplicate device in listNew passphrase: unknown errorBIOCDISCIPLINEOld passphrase: BIOCDELETERAIDno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksnot exactly one partitionioctlPassphrase: BIOCCREATERAID/dev/bioCan't locate %s device via %sBIOCBLINKBIOCINQBIOCVOLinvalid alarm function: %sBIOCALARMdisabledalarm is currently %s %-11s %-10s %14s %-8s VolumeStatusSizeDevice %d%% done %u secondsScrubbingInvalidOnlineOfflineDegradedBuildingRebuildWTWB%s %u%14llu%11s %-10s %14s %-7s CRYPTO%s%s %11s %-10s %14s %-7s CONCAT%s%s %11s %-10s %14s %-7s RAID%u%s%s %s BIOCDISKFailedHot spareUnused %3u%14skey disk%u:%u.%unoenclunknown serial patrol %d%% done%11s %-10s %14s %-7s %-6s <%s> %11s %-10s %14s %-7s %-6s '%s'%s%s stainvalid patrol function: %sPatrol %s: %sBIOCPATROL interval=%d next=%dabortedreadypatrol mode: %s%s patrol status: %s target not specifiedTarget %s: %sDisk %s is not in an enclosureDisk %s does not existinvalid device %sBIOCSETSTATEusage: %s [-hiqv] [-a alarm-function] [-b channel:target[.lun]] [-H channel:target[.lun]] [-R device | channel:target[.lun]] [-t patrol-function] [-u channel:target[.lun]] device %s [-dhiPqsv] [-C flag[,flag,...]] [-c raidlevel] [-k keydisk] [-l special[,special,...]] [-O device | channel:target[.lun]] [-p passfile] [-R device | channel:target[.lun]] [-r rounds] device Invalid RAID levelNumber of rounds is %s: %sa:b:C:c:dH:hik:l:O:Pp:qr:R:st:u:vneed deviceneed -c parameterneed -l parametermust use bio deviceusage: %s seconds do_movemaincpmainusage: %s [-fi] source target %s [-fi] source ... directory cp failedrm failed%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %s%s: destination pathname too longusage: %s [-s] [-M core] [-N system] sM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFmainusage: %s [-s] [name-of-host] sethostnamegethostnamegetnetbyaddrgetnetbynamenetent_add_aliasnetent_set_cnamegetnetnamadr_async_run/etc/networksgethostbyaddrgethostbyname2"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[getaddrinfogetaddrinfo_async_run0.0.0.0127.0.0.1::1/etc/hosts/etc/groupgetpwnam_internalether_hosttonether_ntohost/etc/ethers%02x:%02x:%02x:%02x:%02x:%02xgetnameinfo_numerichosthostent_add_aliashostent_set_cnamegethostnamadr_async_runres_search_async_runsscanf__svfscanf  __find_arguments__vfprintf0123456789ABCDEF0123456789abcdefnanNANinfINFvfprintf %%s NULL in "%s"(null)bug in vfprintf: bad base_res_query_async_ctxvalidate_packetres_send_asyncasr_ctx_add_searchdomain asr_ctx_parseasr_ctx_from_stringasr_ctx_envoptsasr_check_reload#;#nameserverlookupypsearchinet4ndots:lookup bind filenameserver 127.0.0.1RES_OPTIONSoptions LOCALDOMAINsearch lookup file _asr_sockaddr_from_str%d.%d.%d.%d.in-addr.arpa.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.ip6.arpa.no spacetoo shortbad domain namedomain name too longbad dlen@BKMGTPE0B%lld%c%lld.%1lld%cimsg_readmsgbuf_write/dev/diskmap%s%s%s%c%s%s%shmac_sha1pkcs5_pbkdf2pw_write_entrypw_copy=uid is %sroot uid should be 0gid is %swarning, unknown root shell%s:%s:%s:%s:%s:%lld:%lld:%s:%s:%s %s is zero length-d-s-p-u/usr/sbin/pwd_mkdb%s: unchangedre-edit the password file? [y]: %s: line too long%s: corrupted entry%s: inconsistent entry/etc/ptmplogout/var/run/utmplogin_protect%s: %s: %m/etc/fbtab/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m%s: bad entry: %s\\#readlabelfshhVV<VV%sr%s%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in labellogwtmp/var/log/wtmpSipHash0ncdtscsbpxbxfxoxtxdxInfinityNaN/etc/ttyssecurertsctssoftcarwindowinet_net_ptoninet_net_pton_ipv401234567890123456789abcdef/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d inet_pton01234567890123456789ABCDEF0123456789abcdefSHA256EndSHA256DataSHA256FileChunk0123456789abcdefPOSIX_V6_ILP32_OFFBIGPOSIX_V7_ILP32_OFFBIG-lpthread...`)^[Yy]^[Nn]yes/var/run/dev.db[:<:]][:>:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopzeroonetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx regerrorREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***SHA512EndSHA512DataSHA512FileChunk0123456789abcdefBLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blockscrypt_checkpass|77blowfish,8blowfishbcryptbcrypt_hashpassOrpheanBeholderScryDoubtbcrypt_initsaltbcrypt_newhash_bcrypt_autoroundsbcrypt_checkpass6789:;<=>?  !"#$%&'()*+,-./012345./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$2%c$%2.2u$$2b$%2.2u$testpassword 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? GyؗҜ<3#I9=D2[%Cod(hinityan0123456789abcdefABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/readpassphrasetcsetattr  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~glob2glob0NNNWNNNNNNNNNNN,N4 NNOOOOO$O,O4O?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~realpath%u.%u.%u.%uinet6_rth_reverseSHA1TransformSHA1Pad=inet_ntop4inet_ntopgroup_from_giduser_from_uid/etc/shells# /bin/csh/bin/ksh/etc/services,/ ((((( AAAAAABBBBBB <clntudp_callbindresvport_sa !#&(*-/14,QABCDEF7yACnF?O8M20HwZ[%ld]Error %dsnprintfUnknown signal: Unknown error: xqqqqqqqr,r@rTrhrrrrrrrrs$s4sDsXsxsssssss tt(tLt`tttttuu4uLuduuuuuv v0vHvlvvvvvv wDwXwlwwwwwwwxx,xPxdxxxxxxxxy4yHydyxyyyyyyz$z\Undefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedCannot allocate memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC program not availableProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired typeNot supportedNzzzzzz{{,{4{@{T{td{p{|{{{{{{{{ |$|<|T|l|||||HangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2Thread ASTvsnprintf__stack_smash_handler<10>: stack overflow in function `eX ` $0,4@H<!LP`Tx`Od ZOpDx0+2=N)\`PeK\z]XZZ_$d |0H4<DLT\dldx, \8 \8 ? PB | | |  ( + 8. F PJ (unblock and -DNO_CONV? s r p @4r p m x,@`px l@  ,,,841м|^t0 Non-system disk Press any key to reboot NB:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:qr:s:t:u:`{     l x        0    l T t lOT (P/tmp/EdDk.aXXXXXXXXXX3<<<<3<<<<<<<====\H =,=8=@=H=X=`=h=3p=x= ===<<===  x \HV V @V V@@ V @V(@V %(V@ x \H `NV@V_ x\H@d xp ` P(<%̎w%@`wt(؄L`w% z`w&&%(& E8. dA ...08(Pl .p. dA@gg|o~/>~???>ccpp `8 ǃx8 089 pp<cc8` a`p ǃ0 009 0`<cg8` q`` FLJ0 009 8|cf0`8  p089 `f?0?  ?8 `f0   8 `f 1   8 `f 1`İ   08 8 `8 q`8  088 0` `qxp ap8p  008 pp ~??>?~?> 0 4f xǎv|w0xxD\1``bˌ  .&Ș|`` 00( r @ t `"b`11F0 ~sLJ;??~~c   @@? `mF8|x`a1C  mv<88J|LJϜm~|8Z cc `Ș F@F R#cHX $|B b#c0`Ș ,FF gό9>|a`G8p 9>Xa@@@x Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxU<|{$DhLxH|~4D\H~0\cȃLp xl{< \{ w0da8@RLp@Xd84 /  0P^   2?2@2[3\3\ 3]83^D3^X3_d3_p3`3{3{3|3}3}3~344@4\4h444444L44 5545@5 \5h5 |55 55 5| 5566(646X6d66455IKl ܚt  | < X   \c Hx  ؜RuneCT10NONEBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~XOHCl t |     \c  @  t6XClCġԡx`?GMTUTCS @4@ `]<]\]^]DohnoqTrfp5aab,l8X xX x@E@PE@P E@PXF@EXFdFcc| FF .shstrtab.init.text.fini.note.openbsd.ident.rodata.eh_frame.openbsd.randomdata.jcr.ctors.dtors.got.data.bss `e`tt19}}C W\cjoFuP< zwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _rebound:*:52: _unbound:*:53: _dpb:*:54: _pbuild:*:55: _pfetch:*:56: _pkgfetch:*:57: _pkguntar:*:58: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: _smtpd:*:95: _rwalld:*:96: _nsd:*:97: _ldpd:*:98: _sndio:*:99: _ldapd:*:100: _iked:*:101: _iscsid:*:102: _smtpq:*:103: _file:*:104: _radiusd:*:105: _eigrpd:*:106: _vmd:*:107: _tftp_proxy:*:108: _ftp_proxy:*:109: _sndiop:*:110: dialer:*:117: nogroup:*:32766: nobody:*:32767: ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http nfsd 2049/udp nfs nfsd 2049/tcp nfs bin*Binaries Commands and Source//sbin/nologin1binrdrrootdaemonCharlie &/root/bin/ksh2rootdaemonCharlie &/root/bin/ksh3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody f]\W operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}bin*Binaries Commands and Source//sbin/nologin1binpbprootdaemonCharlie &/root/bin/kshs2rootdaemonCharlie &/root/bin/kshs3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody e\[V  operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}Africa/ Africa/Abidjan Africa/Accra Africa/Addis_Ababa Africa/Algiers Africa/Asmara Africa/Asmera Africa/Bamako Africa/Bangui Africa/Banjul Africa/Bissau Africa/Blantyre Africa/Brazzaville Africa/Bujumbura Africa/Cairo Africa/Casablanca Africa/Ceuta Africa/Conakry Africa/Dakar Africa/Dar_es_Salaam Africa/Djibouti Africa/Douala Africa/El_Aaiun Africa/Freetown Africa/Gaborone Africa/Harare Africa/Johannesburg Africa/Juba Africa/Kampala Africa/Khartoum Africa/Kigali Africa/Kinshasa Africa/Lagos Africa/Libreville Africa/Lome Africa/Luanda Africa/Lubumbashi Africa/Lusaka Africa/Malabo Africa/Maputo Africa/Maseru Africa/Mbabane Africa/Mogadishu Africa/Monrovia Africa/Nairobi Africa/Ndjamena Africa/Niamey Africa/Nouakchott Africa/Ouagadougou Africa/Porto-Novo Africa/Sao_Tome Africa/Timbuktu Africa/Tripoli Africa/Tunis Africa/Windhoek America/ America/Adak America/Anchorage America/Anguilla America/Antigua America/Araguaina America/Argentina/ America/Argentina/Buenos_Aires America/Argentina/Catamarca America/Argentina/ComodRivadavia America/Argentina/Cordoba America/Argentina/Jujuy America/Argentina/La_Rioja America/Argentina/Mendoza America/Argentina/Rio_Gallegos America/Argentina/Salta America/Argentina/San_Juan America/Argentina/San_Luis America/Argentina/Tucuman America/Argentina/Ushuaia America/Aruba America/Asuncion America/Atikokan America/Atka America/Bahia America/Bahia_Banderas America/Barbados America/Belem America/Belize America/Blanc-Sablon America/Boa_Vista America/Bogota America/Boise America/Buenos_Aires America/Cambridge_Bay America/Campo_Grande America/Cancun America/Caracas America/Catamarca America/Cayenne America/Cayman America/Chicago America/Chihuahua America/Coral_Harbour America/Cordoba America/Costa_Rica America/Creston America/Cuiaba America/Curacao America/Danmarkshavn America/Dawson America/Dawson_Creek America/Denver America/Detroit America/Dominica America/Edmonton America/Eirunepe America/El_Salvador America/Ensenada America/Fort_Nelson America/Fort_Wayne America/Fortaleza America/Glace_Bay America/Godthab America/Goose_Bay America/Grand_Turk America/Grenada America/Guadeloupe America/Guatemala America/Guayaquil America/Guyana America/Halifax America/Havana America/Hermosillo America/Indiana/ America/Indiana/Indianapolis America/Indiana/Knox America/Indiana/Marengo America/Indiana/Petersburg America/Indiana/Tell_City America/Indiana/Vevay America/Indiana/Vincennes America/Indiana/Winamac America/Indianapolis America/Inuvik America/Iqaluit America/Jamaica America/Jujuy America/Juneau America/Kentucky/ America/Kentucky/Louisville America/Kentucky/Monticello America/Knox_IN America/Kralendijk America/La_Paz America/Lima America/Los_Angeles America/Louisville America/Lower_Princes America/Maceio America/Managua America/Manaus America/Marigot America/Martinique America/Matamoros America/Mazatlan America/Mendoza America/Menominee America/Merida America/Metlakatla America/Mexico_City America/Miquelon America/Moncton America/Monterrey America/Montevideo America/Montreal America/Montserrat America/Nassau America/New_York America/Nipigon America/Nome America/Noronha America/North_Dakota/ America/North_Dakota/Beulah America/North_Dakota/Center America/North_Dakota/New_Salem America/Ojinaga America/Panama America/Pangnirtung America/Paramaribo America/Phoenix America/Port-au-Prince America/Port_of_Spain America/Porto_Acre America/Porto_Velho America/Puerto_Rico America/Rainy_River America/Rankin_Inlet America/Recife America/Regina America/Resolute America/Rio_Branco America/Rosario America/Santa_Isabel America/Santarem America/Santiago America/Santo_Domingo America/Sao_Paulo America/Scoresbysund America/Shiprock America/Sitka America/St_Barthelemy America/St_Johns America/St_Kitts America/St_Lucia America/St_Thomas America/St_Vincent America/Swift_Current America/Tegucigalpa America/Thule America/Thunder_Bay America/Tijuana America/Toronto America/Tortola America/Vancouver America/Virgin America/Whitehorse America/Winnipeg America/Yakutat America/Yellowknife Antarctica/ Antarctica/Casey Antarctica/Davis Antarctica/DumontDUrville Antarctica/Macquarie Antarctica/Mawson Antarctica/McMurdo Antarctica/Palmer Antarctica/Rothera Antarctica/South_Pole Antarctica/Syowa Antarctica/Troll Antarctica/Vostok Arctic/ Arctic/Longyearbyen Asia/ Asia/Aden Asia/Almaty Asia/Amman Asia/Anadyr Asia/Aqtau Asia/Aqtobe Asia/Ashgabat Asia/Ashkhabad Asia/Baghdad Asia/Bahrain Asia/Baku Asia/Bangkok Asia/Barnaul Asia/Beirut Asia/Bishkek Asia/Brunei Asia/Calcutta Asia/Chita Asia/Choibalsan Asia/Chongqing Asia/Chungking Asia/Colombo Asia/Dacca Asia/Damascus Asia/Dhaka Asia/Dili Asia/Dubai Asia/Dushanbe Asia/Gaza Asia/Harbin Asia/Hebron Asia/Ho_Chi_Minh Asia/Hong_Kong Asia/Hovd Asia/Irkutsk Asia/Istanbul Asia/Jakarta Asia/Jayapura Asia/Jerusalem Asia/Kabul Asia/Kamchatka Asia/Karachi Asia/Kashgar Asia/Kathmandu Asia/Katmandu Asia/Khandyga Asia/Kolkata Asia/Krasnoyarsk Asia/Kuala_Lumpur Asia/Kuching Asia/Kuwait Asia/Macao Asia/Macau Asia/Magadan Asia/Makassar Asia/Manila Asia/Muscat Asia/Nicosia Asia/Novokuznetsk Asia/Novosibirsk Asia/Omsk Asia/Oral Asia/Phnom_Penh Asia/Pontianak Asia/Pyongyang Asia/Qatar Asia/Qyzylorda Asia/Rangoon Asia/Riyadh Asia/Riyadh87 Asia/Riyadh88 Asia/Riyadh89 Asia/Saigon Asia/Sakhalin Asia/Samarkand Asia/Seoul Asia/Shanghai Asia/Singapore Asia/Srednekolymsk Asia/Taipei Asia/Tashkent Asia/Tbilisi Asia/Tehran Asia/Tel_Aviv Asia/Thimbu Asia/Thimphu Asia/Tokyo Asia/Tomsk Asia/Ujung_Pandang Asia/Ulaanbaatar Asia/Ulan_Bator Asia/Urumqi Asia/Ust-Nera Asia/Vientiane Asia/Vladivostok Asia/Yakutsk Asia/Yekaterinburg Asia/Yerevan Atlantic/ Atlantic/Azores Atlantic/Bermuda Atlantic/Canary Atlantic/Cape_Verde Atlantic/Faeroe Atlantic/Faroe Atlantic/Jan_Mayen Atlantic/Madeira Atlantic/Reykjavik Atlantic/South_Georgia Atlantic/St_Helena Atlantic/Stanley Australia/ Australia/ACT Australia/Adelaide Australia/Brisbane Australia/Broken_Hill Australia/Canberra Australia/Currie Australia/Darwin Australia/Eucla Australia/Hobart Australia/LHI Australia/Lindeman Australia/Lord_Howe Australia/Melbourne Australia/NSW Australia/North Australia/Perth Australia/Queensland Australia/South Australia/Sydney Australia/Tasmania Australia/Victoria Australia/West Australia/Yancowinna Brazil/ Brazil/Acre Brazil/DeNoronha Brazil/East Brazil/West CET CST6CDT Canada/ Canada/Atlantic Canada/Central Canada/East-Saskatchewan Canada/Eastern Canada/Mountain Canada/Newfoundland Canada/Pacific Canada/Saskatchewan Canada/Yukon Chile/ Chile/Continental Chile/EasterIsland Cuba EET EST EST5EDT Egypt Eire Etc/ Etc/GMT Etc/GMT+0 Etc/GMT+1 Etc/GMT+10 Etc/GMT+11 Etc/GMT+12 Etc/GMT+2 Etc/GMT+3 Etc/GMT+4 Etc/GMT+5 Etc/GMT+6 Etc/GMT+7 Etc/GMT+8 Etc/GMT+9 Etc/GMT-0 Etc/GMT-1 Etc/GMT-10 Etc/GMT-11 Etc/GMT-12 Etc/GMT-13 Etc/GMT-14 Etc/GMT-2 Etc/GMT-3 Etc/GMT-4 Etc/GMT-5 Etc/GMT-6 Etc/GMT-7 Etc/GMT-8 Etc/GMT-9 Etc/GMT0 Etc/Greenwich Etc/UCT Etc/UTC Etc/Universal Etc/Zulu Europe/ Europe/Amsterdam Europe/Andorra Europe/Astrakhan Europe/Athens Europe/Belfast Europe/Belgrade Europe/Berlin Europe/Bratislava Europe/Brussels Europe/Bucharest Europe/Budapest Europe/Busingen Europe/Chisinau Europe/Copenhagen Europe/Dublin Europe/Gibraltar Europe/Guernsey Europe/Helsinki Europe/Isle_of_Man Europe/Istanbul Europe/Jersey Europe/Kaliningrad Europe/Kiev Europe/Kirov Europe/Lisbon Europe/Ljubljana Europe/London Europe/Luxembourg Europe/Madrid Europe/Malta Europe/Mariehamn Europe/Minsk Europe/Monaco Europe/Moscow Europe/Nicosia Europe/Oslo Europe/Paris Europe/Podgorica Europe/Prague Europe/Riga Europe/Rome Europe/Samara Europe/San_Marino Europe/Sarajevo Europe/Simferopol Europe/Skopje Europe/Sofia Europe/Stockholm Europe/Tallinn Europe/Tirane Europe/Tiraspol Europe/Ulyanovsk Europe/Uzhgorod Europe/Vaduz Europe/Vatican Europe/Vienna Europe/Vilnius Europe/Volgograd Europe/Warsaw Europe/Zagreb Europe/Zaporozhye Europe/Zurich Factory GB GB-Eire GMT GMT+0 GMT-0 GMT0 Greenwich HST Hongkong Iceland Indian/ Indian/Antananarivo Indian/Chagos Indian/Christmas Indian/Cocos Indian/Comoro Indian/Kerguelen Indian/Mahe Indian/Maldives Indian/Mauritius Indian/Mayotte Indian/Reunion Iran Israel Jamaica Japan Kwajalein Libya MET MST MST7MDT Mexico/ Mexico/BajaNorte Mexico/BajaSur Mexico/General Mideast/ Mideast/Riyadh87 Mideast/Riyadh88 Mideast/Riyadh89 NZ NZ-CHAT Navajo PRC PST8PDT Pacific/ Pacific/Apia Pacific/Auckland Pacific/Bougainville Pacific/Chatham Pacific/Chuuk Pacific/Easter Pacific/Efate Pacific/Enderbury Pacific/Fakaofo Pacific/Fiji Pacific/Funafuti Pacific/Galapagos Pacific/Gambier Pacific/Guadalcanal Pacific/Guam Pacific/Honolulu Pacific/Johnston Pacific/Kiritimati Pacific/Kosrae Pacific/Kwajalein Pacific/Majuro Pacific/Marquesas Pacific/Midway Pacific/Nauru Pacific/Niue Pacific/Norfolk Pacific/Noumea Pacific/Pago_Pago Pacific/Palau Pacific/Pitcairn Pacific/Pohnpei Pacific/Ponape Pacific/Port_Moresby Pacific/Rarotonga Pacific/Saipan Pacific/Samoa Pacific/Tahiti Pacific/Tarawa Pacific/Tongatapu Pacific/Truk Pacific/Wake Pacific/Wallis Pacific/Yap Poland Portugal ROC ROK Singapore Turkey UCT US/ US/Alaska US/Aleutian US/Arizona US/Central US/East-Indiana US/Eastern US/Hawaii US/Indiana-Starke US/Michigan US/Mountain US/Pacific US/Pacific-New US/Samoa UTC Universal W-SU WET Zulu posix/ posix/Africa/ posix/Africa/Abidjan posix/Africa/Accra posix/Africa/Addis_Ababa posix/Africa/Algiers posix/Africa/Asmara posix/Africa/Asmera posix/Africa/Bamako posix/Africa/Bangui posix/Africa/Banjul posix/Africa/Bissau posix/Africa/Blantyre posix/Africa/Brazzaville posix/Africa/Bujumbura posix/Africa/Cairo posix/Africa/Casablanca posix/Africa/Ceuta posix/Africa/Conakry posix/Africa/Dakar posix/Africa/Dar_es_Salaam posix/Africa/Djibouti posix/Africa/Douala posix/Africa/El_Aaiun posix/Africa/Freetown posix/Africa/Gaborone posix/Africa/Harare posix/Africa/Johannesburg posix/Africa/Juba posix/Africa/Kampala posix/Africa/Khartoum posix/Africa/Kigali posix/Africa/Kinshasa posix/Africa/Lagos posix/Africa/Libreville posix/Africa/Lome posix/Africa/Luanda posix/Africa/Lubumbashi posix/Africa/Lusaka posix/Africa/Malabo posix/Africa/Maputo posix/Africa/Maseru posix/Africa/Mbabane posix/Africa/Mogadishu posix/Africa/Monrovia posix/Africa/Nairobi posix/Africa/Ndjamena posix/Africa/Niamey posix/Africa/Nouakchott posix/Africa/Ouagadougou posix/Africa/Porto-Novo posix/Africa/Sao_Tome posix/Africa/Timbuktu posix/Africa/Tripoli posix/Africa/Tunis posix/Africa/Windhoek posix/America/ posix/America/Adak posix/America/Anchorage posix/America/Anguilla posix/America/Antigua posix/America/Araguaina posix/America/Argentina/ posix/America/Argentina/Buenos_Aires posix/America/Argentina/Catamarca posix/America/Argentina/ComodRivadavia posix/America/Argentina/Cordoba posix/America/Argentina/Jujuy posix/America/Argentina/La_Rioja posix/America/Argentina/Mendoza posix/America/Argentina/Rio_Gallegos posix/America/Argentina/Salta posix/America/Argentina/San_Juan posix/America/Argentina/San_Luis posix/America/Argentina/Tucuman posix/America/Argentina/Ushuaia posix/America/Aruba posix/America/Asuncion posix/America/Atikokan posix/America/Atka posix/America/Bahia posix/America/Bahia_Banderas posix/America/Barbados posix/America/Belem posix/America/Belize posix/America/Blanc-Sablon posix/America/Boa_Vista posix/America/Bogota posix/America/Boise posix/America/Buenos_Aires posix/America/Cambridge_Bay posix/America/Campo_Grande posix/America/Cancun posix/America/Caracas posix/America/Catamarca posix/America/Cayenne posix/America/Cayman posix/America/Chicago posix/America/Chihuahua posix/America/Coral_Harbour posix/America/Cordoba posix/America/Costa_Rica posix/America/Creston posix/America/Cuiaba posix/America/Curacao posix/America/Danmarkshavn posix/America/Dawson posix/America/Dawson_Creek posix/America/Denver posix/America/Detroit posix/America/Dominica posix/America/Edmonton posix/America/Eirunepe posix/America/El_Salvador posix/America/Ensenada posix/America/Fort_Nelson posix/America/Fort_Wayne posix/America/Fortaleza posix/America/Glace_Bay posix/America/Godthab posix/America/Goose_Bay posix/America/Grand_Turk posix/America/Grenada posix/America/Guadeloupe posix/America/Guatemala posix/America/Guayaquil posix/America/Guyana posix/America/Halifax posix/America/Havana posix/America/Hermosillo posix/America/Indiana/ posix/America/Indiana/Indianapolis posix/America/Indiana/Knox posix/America/Indiana/Marengo posix/America/Indiana/Petersburg posix/America/Indiana/Tell_City posix/America/Indiana/Vevay posix/America/Indiana/Vincennes posix/America/Indiana/Winamac posix/America/Indianapolis posix/America/Inuvik posix/America/Iqaluit posix/America/Jamaica posix/America/Jujuy posix/America/Juneau posix/America/Kentucky/ posix/America/Kentucky/Louisville posix/America/Kentucky/Monticello posix/America/Knox_IN posix/America/Kralendijk posix/America/La_Paz posix/America/Lima posix/America/Los_Angeles posix/America/Louisville posix/America/Lower_Princes posix/America/Maceio posix/America/Managua posix/America/Manaus posix/America/Marigot posix/America/Martinique posix/America/Matamoros posix/America/Mazatlan posix/America/Mendoza posix/America/Menominee posix/America/Merida posix/America/Metlakatla posix/America/Mexico_City posix/America/Miquelon posix/America/Moncton posix/America/Monterrey posix/America/Montevideo posix/America/Montreal posix/America/Montserrat posix/America/Nassau posix/America/New_York posix/America/Nipigon posix/America/Nome posix/America/Noronha posix/America/North_Dakota/ posix/America/North_Dakota/Beulah posix/America/North_Dakota/Center posix/America/North_Dakota/New_Salem posix/America/Ojinaga posix/America/Panama posix/America/Pangnirtung posix/America/Paramaribo posix/America/Phoenix posix/America/Port-au-Prince posix/America/Port_of_Spain posix/America/Porto_Acre posix/America/Porto_Velho posix/America/Puerto_Rico posix/America/Rainy_River posix/America/Rankin_Inlet posix/America/Recife posix/America/Regina posix/America/Resolute posix/America/Rio_Branco posix/America/Rosario posix/America/Santa_Isabel posix/America/Santarem posix/America/Santiago posix/America/Santo_Domingo posix/America/Sao_Paulo posix/America/Scoresbysund posix/America/Shiprock posix/America/Sitka posix/America/St_Barthelemy posix/America/St_Johns posix/America/St_Kitts posix/America/St_Lucia posix/America/St_Thomas posix/America/St_Vincent posix/America/Swift_Current posix/America/Tegucigalpa posix/America/Thule posix/America/Thunder_Bay posix/America/Tijuana posix/America/Toronto posix/America/Tortola posix/America/Vancouver posix/America/Virgin posix/America/Whitehorse posix/America/Winnipeg posix/America/Yakutat posix/America/Yellowknife posix/Antarctica/ posix/Antarctica/Casey posix/Antarctica/Davis posix/Antarctica/DumontDUrville posix/Antarctica/Macquarie posix/Antarctica/Mawson posix/Antarctica/McMurdo posix/Antarctica/Palmer posix/Antarctica/Rothera posix/Antarctica/South_Pole posix/Antarctica/Syowa posix/Antarctica/Troll posix/Antarctica/Vostok posix/Arctic/ posix/Arctic/Longyearbyen posix/Asia/ posix/Asia/Aden posix/Asia/Almaty posix/Asia/Amman posix/Asia/Anadyr posix/Asia/Aqtau posix/Asia/Aqtobe posix/Asia/Ashgabat posix/Asia/Ashkhabad posix/Asia/Baghdad posix/Asia/Bahrain posix/Asia/Baku posix/Asia/Bangkok posix/Asia/Barnaul posix/Asia/Beirut posix/Asia/Bishkek posix/Asia/Brunei posix/Asia/Calcutta posix/Asia/Chita posix/Asia/Choibalsan posix/Asia/Chongqing posix/Asia/Chungking posix/Asia/Colombo posix/Asia/Dacca posix/Asia/Damascus posix/Asia/Dhaka posix/Asia/Dili posix/Asia/Dubai posix/Asia/Dushanbe posix/Asia/Gaza posix/Asia/Harbin posix/Asia/Hebron posix/Asia/Ho_Chi_Minh posix/Asia/Hong_Kong posix/Asia/Hovd posix/Asia/Irkutsk posix/Asia/Istanbul posix/Asia/Jakarta posix/Asia/Jayapura posix/Asia/Jerusalem posix/Asia/Kabul posix/Asia/Kamchatka posix/Asia/Karachi posix/Asia/Kashgar posix/Asia/Kathmandu posix/Asia/Katmandu posix/Asia/Khandyga posix/Asia/Kolkata posix/Asia/Krasnoyarsk posix/Asia/Kuala_Lumpur posix/Asia/Kuching posix/Asia/Kuwait posix/Asia/Macao posix/Asia/Macau posix/Asia/Magadan posix/Asia/Makassar posix/Asia/Manila posix/Asia/Muscat posix/Asia/Nicosia posix/Asia/Novokuznetsk posix/Asia/Novosibirsk posix/Asia/Omsk posix/Asia/Oral posix/Asia/Phnom_Penh posix/Asia/Pontianak posix/Asia/Pyongyang posix/Asia/Qatar posix/Asia/Qyzylorda posix/Asia/Rangoon posix/Asia/Riyadh posix/Asia/Riyadh87 posix/Asia/Riyadh88 posix/Asia/Riyadh89 posix/Asia/Saigon posix/Asia/Sakhalin posix/Asia/Samarkand posix/Asia/Seoul posix/Asia/Shanghai posix/Asia/Singapore posix/Asia/Srednekolymsk posix/Asia/Taipei posix/Asia/Tashkent posix/Asia/Tbilisi posix/Asia/Tehran posix/Asia/Tel_Aviv posix/Asia/Thimbu posix/Asia/Thimphu posix/Asia/Tokyo posix/Asia/Tomsk posix/Asia/Ujung_Pandang posix/Asia/Ulaanbaatar posix/Asia/Ulan_Bator posix/Asia/Urumqi posix/Asia/Ust-Nera posix/Asia/Vientiane posix/Asia/Vladivostok posix/Asia/Yakutsk posix/Asia/Yekaterinburg posix/Asia/Yerevan posix/Atlantic/ posix/Atlantic/Azores posix/Atlantic/Bermuda posix/Atlantic/Canary posix/Atlantic/Cape_Verde posix/Atlantic/Faeroe posix/Atlantic/Faroe posix/Atlantic/Jan_Mayen posix/Atlantic/Madeira posix/Atlantic/Reykjavik posix/Atlantic/South_Georgia posix/Atlantic/St_Helena posix/Atlantic/Stanley posix/Australia/ posix/Australia/ACT posix/Australia/Adelaide posix/Australia/Brisbane posix/Australia/Broken_Hill posix/Australia/Canberra posix/Australia/Currie posix/Australia/Darwin posix/Australia/Eucla posix/Australia/Hobart posix/Australia/LHI posix/Australia/Lindeman posix/Australia/Lord_Howe posix/Australia/Melbourne posix/Australia/NSW posix/Australia/North posix/Australia/Perth posix/Australia/Queensland posix/Australia/South posix/Australia/Sydney posix/Australia/Tasmania posix/Australia/Victoria posix/Australia/West posix/Australia/Yancowinna posix/Brazil/ posix/Brazil/Acre posix/Brazil/DeNoronha posix/Brazil/East posix/Brazil/West posix/CET posix/CST6CDT posix/Canada/ posix/Canada/Atlantic posix/Canada/Central posix/Canada/East-Saskatchewan posix/Canada/Eastern posix/Canada/Mountain posix/Canada/Newfoundland posix/Canada/Pacific posix/Canada/Saskatchewan posix/Canada/Yukon posix/Chile/ posix/Chile/Continental posix/Chile/EasterIsland posix/Cuba posix/EET posix/EST posix/EST5EDT posix/Egypt posix/Eire posix/Etc/ posix/Etc/GMT posix/Etc/GMT+0 posix/Etc/GMT+1 posix/Etc/GMT+10 posix/Etc/GMT+11 posix/Etc/GMT+12 posix/Etc/GMT+2 posix/Etc/GMT+3 posix/Etc/GMT+4 posix/Etc/GMT+5 posix/Etc/GMT+6 posix/Etc/GMT+7 posix/Etc/GMT+8 posix/Etc/GMT+9 posix/Etc/GMT-0 posix/Etc/GMT-1 posix/Etc/GMT-10 posix/Etc/GMT-11 posix/Etc/GMT-12 posix/Etc/GMT-13 posix/Etc/GMT-14 posix/Etc/GMT-2 posix/Etc/GMT-3 posix/Etc/GMT-4 posix/Etc/GMT-5 posix/Etc/GMT-6 posix/Etc/GMT-7 posix/Etc/GMT-8 posix/Etc/GMT-9 posix/Etc/GMT0 posix/Etc/Greenwich posix/Etc/UCT posix/Etc/UTC posix/Etc/Universal posix/Etc/Zulu posix/Europe/ posix/Europe/Amsterdam posix/Europe/Andorra posix/Europe/Astrakhan posix/Europe/Athens posix/Europe/Belfast posix/Europe/Belgrade posix/Europe/Berlin posix/Europe/Bratislava posix/Europe/Brussels posix/Europe/Bucharest posix/Europe/Budapest posix/Europe/Busingen posix/Europe/Chisinau posix/Europe/Copenhagen posix/Europe/Dublin posix/Europe/Gibraltar posix/Europe/Guernsey posix/Europe/Helsinki posix/Europe/Isle_of_Man posix/Europe/Istanbul posix/Europe/Jersey posix/Europe/Kaliningrad posix/Europe/Kiev posix/Europe/Kirov posix/Europe/Lisbon posix/Europe/Ljubljana posix/Europe/London posix/Europe/Luxembourg posix/Europe/Madrid posix/Europe/Malta posix/Europe/Mariehamn posix/Europe/Minsk posix/Europe/Monaco posix/Europe/Moscow posix/Europe/Nicosia posix/Europe/Oslo posix/Europe/Paris posix/Europe/Podgorica posix/Europe/Prague posix/Europe/Riga posix/Europe/Rome posix/Europe/Samara posix/Europe/San_Marino posix/Europe/Sarajevo posix/Europe/Simferopol posix/Europe/Skopje posix/Europe/Sofia posix/Europe/Stockholm posix/Europe/Tallinn posix/Europe/Tirane posix/Europe/Tiraspol posix/Europe/Ulyanovsk posix/Europe/Uzhgorod posix/Europe/Vaduz posix/Europe/Vatican posix/Europe/Vienna posix/Europe/Vilnius posix/Europe/Volgograd posix/Europe/Warsaw posix/Europe/Zagreb posix/Europe/Zaporozhye posix/Europe/Zurich posix/Factory posix/GB posix/GB-Eire posix/GMT posix/GMT+0 posix/GMT-0 posix/GMT0 posix/Greenwich posix/HST posix/Hongkong posix/Iceland posix/Indian/ posix/Indian/Antananarivo posix/Indian/Chagos posix/Indian/Christmas posix/Indian/Cocos posix/Indian/Comoro posix/Indian/Kerguelen posix/Indian/Mahe posix/Indian/Maldives posix/Indian/Mauritius posix/Indian/Mayotte posix/Indian/Reunion posix/Iran posix/Israel posix/Jamaica posix/Japan posix/Kwajalein posix/Libya posix/MET posix/MST posix/MST7MDT posix/Mexico/ posix/Mexico/BajaNorte posix/Mexico/BajaSur posix/Mexico/General posix/Mideast/ posix/Mideast/Riyadh87 posix/Mideast/Riyadh88 posix/Mideast/Riyadh89 posix/NZ posix/NZ-CHAT posix/Navajo posix/PRC posix/PST8PDT posix/Pacific/ posix/Pacific/Apia posix/Pacific/Auckland posix/Pacific/Bougainville posix/Pacific/Chatham posix/Pacific/Chuuk posix/Pacific/Easter posix/Pacific/Efate posix/Pacific/Enderbury posix/Pacific/Fakaofo posix/Pacific/Fiji posix/Pacific/Funafuti posix/Pacific/Galapagos posix/Pacific/Gambier posix/Pacific/Guadalcanal posix/Pacific/Guam posix/Pacific/Honolulu posix/Pacific/Johnston posix/Pacific/Kiritimati posix/Pacific/Kosrae posix/Pacific/Kwajalein posix/Pacific/Majuro posix/Pacific/Marquesas posix/Pacific/Midway posix/Pacific/Nauru posix/Pacific/Niue posix/Pacific/Norfolk posix/Pacific/Noumea posix/Pacific/Pago_Pago posix/Pacific/Palau posix/Pacific/Pitcairn posix/Pacific/Pohnpei posix/Pacific/Ponape posix/Pacific/Port_Moresby posix/Pacific/Rarotonga posix/Pacific/Saipan posix/Pacific/Samoa posix/Pacific/Tahiti posix/Pacific/Tarawa posix/Pacific/Tongatapu posix/Pacific/Truk posix/Pacific/Wake posix/Pacific/Wallis posix/Pacific/Yap posix/Poland posix/Portugal posix/ROC posix/ROK posix/Singapore posix/Turkey posix/UCT posix/US/ posix/US/Alaska posix/US/Aleutian posix/US/Arizona posix/US/Central posix/US/East-Indiana posix/US/Eastern posix/US/Hawaii posix/US/Indiana-Starke posix/US/Michigan posix/US/Mountain posix/US/Pacific posix/US/Pacific-New posix/US/Samoa posix/UTC posix/Universal posix/W-SU posix/WET posix/Zulu posixrules right/ right/Africa/ right/Africa/Abidjan right/Africa/Accra right/Africa/Addis_Ababa right/Africa/Algiers right/Africa/Asmara right/Africa/Asmera right/Africa/Bamako right/Africa/Bangui right/Africa/Banjul right/Africa/Bissau right/Africa/Blantyre right/Africa/Brazzaville right/Africa/Bujumbura right/Africa/Cairo right/Africa/Casablanca right/Africa/Ceuta right/Africa/Conakry right/Africa/Dakar right/Africa/Dar_es_Salaam right/Africa/Djibouti right/Africa/Douala right/Africa/El_Aaiun right/Africa/Freetown right/Africa/Gaborone right/Africa/Harare right/Africa/Johannesburg right/Africa/Juba right/Africa/Kampala right/Africa/Khartoum right/Africa/Kigali right/Africa/Kinshasa right/Africa/Lagos right/Africa/Libreville right/Africa/Lome right/Africa/Luanda right/Africa/Lubumbashi right/Africa/Lusaka right/Africa/Malabo right/Africa/Maputo right/Africa/Maseru right/Africa/Mbabane right/Africa/Mogadishu right/Africa/Monrovia right/Africa/Nairobi right/Africa/Ndjamena right/Africa/Niamey right/Africa/Nouakchott right/Africa/Ouagadougou right/Africa/Porto-Novo right/Africa/Sao_Tome right/Africa/Timbuktu right/Africa/Tripoli right/Africa/Tunis right/Africa/Windhoek right/America/ right/America/Adak right/America/Anchorage right/America/Anguilla right/America/Antigua right/America/Araguaina right/America/Argentina/ right/America/Argentina/Buenos_Aires right/America/Argentina/Catamarca right/America/Argentina/ComodRivadavia right/America/Argentina/Cordoba right/America/Argentina/Jujuy right/America/Argentina/La_Rioja right/America/Argentina/Mendoza right/America/Argentina/Rio_Gallegos right/America/Argentina/Salta right/America/Argentina/San_Juan right/America/Argentina/San_Luis right/America/Argentina/Tucuman right/America/Argentina/Ushuaia right/America/Aruba right/America/Asuncion right/America/Atikokan right/America/Atka right/America/Bahia right/America/Bahia_Banderas right/America/Barbados right/America/Belem right/America/Belize right/America/Blanc-Sablon right/America/Boa_Vista right/America/Bogota right/America/Boise right/America/Buenos_Aires right/America/Cambridge_Bay right/America/Campo_Grande right/America/Cancun right/America/Caracas right/America/Catamarca right/America/Cayenne right/America/Cayman right/America/Chicago right/America/Chihuahua right/America/Coral_Harbour right/America/Cordoba right/America/Costa_Rica right/America/Creston right/America/Cuiaba right/America/Curacao right/America/Danmarkshavn right/America/Dawson right/America/Dawson_Creek right/America/Denver right/America/Detroit right/America/Dominica right/America/Edmonton right/America/Eirunepe right/America/El_Salvador right/America/Ensenada right/America/Fort_Nelson right/America/Fort_Wayne right/America/Fortaleza right/America/Glace_Bay right/America/Godthab right/America/Goose_Bay right/America/Grand_Turk right/America/Grenada right/America/Guadeloupe right/America/Guatemala right/America/Guayaquil right/America/Guyana right/America/Halifax right/America/Havana right/America/Hermosillo right/America/Indiana/ right/America/Indiana/Indianapolis right/America/Indiana/Knox right/America/Indiana/Marengo right/America/Indiana/Petersburg right/America/Indiana/Tell_City right/America/Indiana/Vevay right/America/Indiana/Vincennes right/America/Indiana/Winamac right/America/Indianapolis right/America/Inuvik right/America/Iqaluit right/America/Jamaica right/America/Jujuy right/America/Juneau right/America/Kentucky/ right/America/Kentucky/Louisville right/America/Kentucky/Monticello right/America/Knox_IN right/America/Kralendijk right/America/La_Paz right/America/Lima right/America/Los_Angeles right/America/Louisville right/America/Lower_Princes right/America/Maceio right/America/Managua right/America/Manaus right/America/Marigot right/America/Martinique right/America/Matamoros right/America/Mazatlan right/America/Mendoza right/America/Menominee right/America/Merida right/America/Metlakatla right/America/Mexico_City right/America/Miquelon right/America/Moncton right/America/Monterrey right/America/Montevideo right/America/Montreal right/America/Montserrat right/America/Nassau right/America/New_York right/America/Nipigon right/America/Nome right/America/Noronha right/America/North_Dakota/ right/America/North_Dakota/Beulah right/America/North_Dakota/Center right/America/North_Dakota/New_Salem right/America/Ojinaga right/America/Panama right/America/Pangnirtung right/America/Paramaribo right/America/Phoenix right/America/Port-au-Prince right/America/Port_of_Spain right/America/Porto_Acre right/America/Porto_Velho right/America/Puerto_Rico right/America/Rainy_River right/America/Rankin_Inlet right/America/Recife right/America/Regina right/America/Resolute right/America/Rio_Branco right/America/Rosario right/America/Santa_Isabel right/America/Santarem right/America/Santiago right/America/Santo_Domingo right/America/Sao_Paulo right/America/Scoresbysund right/America/Shiprock right/America/Sitka right/America/St_Barthelemy right/America/St_Johns right/America/St_Kitts right/America/St_Lucia right/America/St_Thomas right/America/St_Vincent right/America/Swift_Current right/America/Tegucigalpa right/America/Thule right/America/Thunder_Bay right/America/Tijuana right/America/Toronto right/America/Tortola right/America/Vancouver right/America/Virgin right/America/Whitehorse right/America/Winnipeg right/America/Yakutat right/America/Yellowknife right/Antarctica/ right/Antarctica/Casey right/Antarctica/Davis right/Antarctica/DumontDUrville right/Antarctica/Macquarie right/Antarctica/Mawson right/Antarctica/McMurdo right/Antarctica/Palmer right/Antarctica/Rothera right/Antarctica/South_Pole right/Antarctica/Syowa right/Antarctica/Troll right/Antarctica/Vostok right/Arctic/ right/Arctic/Longyearbyen right/Asia/ right/Asia/Aden right/Asia/Almaty right/Asia/Amman right/Asia/Anadyr right/Asia/Aqtau right/Asia/Aqtobe right/Asia/Ashgabat right/Asia/Ashkhabad right/Asia/Baghdad right/Asia/Bahrain right/Asia/Baku right/Asia/Bangkok right/Asia/Barnaul right/Asia/Beirut right/Asia/Bishkek right/Asia/Brunei right/Asia/Calcutta right/Asia/Chita right/Asia/Choibalsan right/Asia/Chongqing right/Asia/Chungking right/Asia/Colombo right/Asia/Dacca right/Asia/Damascus right/Asia/Dhaka right/Asia/Dili right/Asia/Dubai right/Asia/Dushanbe right/Asia/Gaza right/Asia/Harbin right/Asia/Hebron right/Asia/Ho_Chi_Minh right/Asia/Hong_Kong right/Asia/Hovd right/Asia/Irkutsk right/Asia/Istanbul right/Asia/Jakarta right/Asia/Jayapura right/Asia/Jerusalem right/Asia/Kabul right/Asia/Kamchatka right/Asia/Karachi right/Asia/Kashgar right/Asia/Kathmandu right/Asia/Katmandu right/Asia/Khandyga right/Asia/Kolkata right/Asia/Krasnoyarsk right/Asia/Kuala_Lumpur right/Asia/Kuching right/Asia/Kuwait right/Asia/Macao right/Asia/Macau right/Asia/Magadan right/Asia/Makassar right/Asia/Manila right/Asia/Muscat right/Asia/Nicosia right/Asia/Novokuznetsk right/Asia/Novosibirsk right/Asia/Omsk right/Asia/Oral right/Asia/Phnom_Penh right/Asia/Pontianak right/Asia/Pyongyang right/Asia/Qatar right/Asia/Qyzylorda right/Asia/Rangoon right/Asia/Riyadh right/Asia/Riyadh87 right/Asia/Riyadh88 right/Asia/Riyadh89 right/Asia/Saigon right/Asia/Sakhalin right/Asia/Samarkand right/Asia/Seoul right/Asia/Shanghai right/Asia/Singapore right/Asia/Srednekolymsk right/Asia/Taipei right/Asia/Tashkent right/Asia/Tbilisi right/Asia/Tehran right/Asia/Tel_Aviv right/Asia/Thimbu right/Asia/Thimphu right/Asia/Tokyo right/Asia/Tomsk right/Asia/Ujung_Pandang right/Asia/Ulaanbaatar right/Asia/Ulan_Bator right/Asia/Urumqi right/Asia/Ust-Nera right/Asia/Vientiane right/Asia/Vladivostok right/Asia/Yakutsk right/Asia/Yekaterinburg right/Asia/Yerevan right/Atlantic/ right/Atlantic/Azores right/Atlantic/Bermuda right/Atlantic/Canary right/Atlantic/Cape_Verde right/Atlantic/Faeroe right/Atlantic/Faroe right/Atlantic/Jan_Mayen right/Atlantic/Madeira right/Atlantic/Reykjavik right/Atlantic/South_Georgia right/Atlantic/St_Helena right/Atlantic/Stanley right/Australia/ right/Australia/ACT right/Australia/Adelaide right/Australia/Brisbane right/Australia/Broken_Hill right/Australia/Canberra right/Australia/Currie right/Australia/Darwin right/Australia/Eucla right/Australia/Hobart right/Australia/LHI right/Australia/Lindeman right/Australia/Lord_Howe right/Australia/Melbourne right/Australia/NSW right/Australia/North right/Australia/Perth right/Australia/Queensland right/Australia/South right/Australia/Sydney right/Australia/Tasmania right/Australia/Victoria right/Australia/West right/Australia/Yancowinna right/Brazil/ right/Brazil/Acre right/Brazil/DeNoronha right/Brazil/East right/Brazil/West right/CET right/CST6CDT right/Canada/ right/Canada/Atlantic right/Canada/Central right/Canada/East-Saskatchewan right/Canada/Eastern right/Canada/Mountain right/Canada/Newfoundland right/Canada/Pacific right/Canada/Saskatchewan right/Canada/Yukon right/Chile/ right/Chile/Continental right/Chile/EasterIsland right/Cuba right/EET right/EST right/EST5EDT right/Egypt right/Eire right/Etc/ right/Etc/GMT right/Etc/GMT+0 right/Etc/GMT+1 right/Etc/GMT+10 right/Etc/GMT+11 right/Etc/GMT+12 right/Etc/GMT+2 right/Etc/GMT+3 right/Etc/GMT+4 right/Etc/GMT+5 right/Etc/GMT+6 right/Etc/GMT+7 right/Etc/GMT+8 right/Etc/GMT+9 right/Etc/GMT-0 right/Etc/GMT-1 right/Etc/GMT-10 right/Etc/GMT-11 right/Etc/GMT-12 right/Etc/GMT-13 right/Etc/GMT-14 right/Etc/GMT-2 right/Etc/GMT-3 right/Etc/GMT-4 right/Etc/GMT-5 right/Etc/GMT-6 right/Etc/GMT-7 right/Etc/GMT-8 right/Etc/GMT-9 right/Etc/GMT0 right/Etc/Greenwich right/Etc/UCT right/Etc/UTC right/Etc/Universal right/Etc/Zulu right/Europe/ right/Europe/Amsterdam right/Europe/Andorra right/Europe/Astrakhan right/Europe/Athens right/Europe/Belfast right/Europe/Belgrade right/Europe/Berlin right/Europe/Bratislava right/Europe/Brussels right/Europe/Bucharest right/Europe/Budapest right/Europe/Busingen right/Europe/Chisinau right/Europe/Copenhagen right/Europe/Dublin right/Europe/Gibraltar right/Europe/Guernsey right/Europe/Helsinki right/Europe/Isle_of_Man right/Europe/Istanbul right/Europe/Jersey right/Europe/Kaliningrad right/Europe/Kiev right/Europe/Kirov right/Europe/Lisbon right/Europe/Ljubljana right/Europe/London right/Europe/Luxembourg right/Europe/Madrid right/Europe/Malta right/Europe/Mariehamn right/Europe/Minsk right/Europe/Monaco right/Europe/Moscow right/Europe/Nicosia right/Europe/Oslo right/Europe/Paris right/Europe/Podgorica right/Europe/Prague right/Europe/Riga right/Europe/Rome right/Europe/Samara right/Europe/San_Marino right/Europe/Sarajevo right/Europe/Simferopol right/Europe/Skopje right/Europe/Sofia right/Europe/Stockholm right/Europe/Tallinn right/Europe/Tirane right/Europe/Tiraspol right/Europe/Ulyanovsk right/Europe/Uzhgorod right/Europe/Vaduz right/Europe/Vatican right/Europe/Vienna right/Europe/Vilnius right/Europe/Volgograd right/Europe/Warsaw right/Europe/Zagreb right/Europe/Zaporozhye right/Europe/Zurich right/Factory right/GB right/GB-Eire right/GMT right/GMT+0 right/GMT-0 right/GMT0 right/Greenwich right/HST right/Hongkong right/Iceland right/Indian/ right/Indian/Antananarivo right/Indian/Chagos right/Indian/Christmas right/Indian/Cocos right/Indian/Comoro right/Indian/Kerguelen right/Indian/Mahe right/Indian/Maldives right/Indian/Mauritius right/Indian/Mayotte right/Indian/Reunion right/Iran right/Israel right/Jamaica right/Japan right/Kwajalein right/Libya right/MET right/MST right/MST7MDT right/Mexico/ right/Mexico/BajaNorte right/Mexico/BajaSur right/Mexico/General right/Mideast/ right/Mideast/Riyadh87 right/Mideast/Riyadh88 right/Mideast/Riyadh89 right/NZ right/NZ-CHAT right/Navajo right/PRC right/PST8PDT right/Pacific/ right/Pacific/Apia right/Pacific/Auckland right/Pacific/Bougainville right/Pacific/Chatham right/Pacific/Chuuk right/Pacific/Easter right/Pacific/Efate right/Pacific/Enderbury right/Pacific/Fakaofo right/Pacific/Fiji right/Pacific/Funafuti right/Pacific/Galapagos right/Pacific/Gambier right/Pacific/Guadalcanal right/Pacific/Guam right/Pacific/Honolulu right/Pacific/Johnston right/Pacific/Kiritimati right/Pacific/Kosrae right/Pacific/Kwajalein right/Pacific/Majuro right/Pacific/Marquesas right/Pacific/Midway right/Pacific/Nauru right/Pacific/Niue right/Pacific/Norfolk right/Pacific/Noumea right/Pacific/Pago_Pago right/Pacific/Palau right/Pacific/Pitcairn right/Pacific/Pohnpei right/Pacific/Ponape right/Pacific/Port_Moresby right/Pacific/Rarotonga right/Pacific/Saipan right/Pacific/Samoa right/Pacific/Tahiti right/Pacific/Tarawa right/Pacific/Tongatapu right/Pacific/Truk right/Pacific/Wake right/Pacific/Wallis right/Pacific/Yap right/Poland right/Portugal right/ROC right/ROK right/Singapore right/Turkey right/UCT right/US/ right/US/Alaska right/US/Aleutian right/US/Arizona right/US/Central right/US/East-Indiana right/US/Eastern right/US/Hawaii right/US/Indiana-Starke right/US/Michigan right/US/Mountain right/US/Pacific right/US/Pacific-New right/US/Samoa right/UTC right/Universal right/W-SU right/WET right/Zulu 08`EW<  EW6*`[~ [~EW`@@<@TU mW bmWA HWxi2UW,q7UW,q7x9qAIW٧IW٧IWݨ a3AIWwXIW32IW6s7b,AIW"RW?Q|1RW?Q|1c@/AIW`$IW`$IWې*&d1AIW3B6WWU WWU eOVWg;V SWV SWV hp P~!TW7,TW7,TW7,-!TWׯO-TWׯO-TWׯO-=84!TW۰.TW۰.UW,q7nbGN!TW߱/TW߱/UWLa;9Ve!TWmJ0TWmJ0TWmJ0!TWn{1TWn{1TWn{1 #K!TW82TW82TW82lw!TW,E3TW,E3TW,E33!TWXv4TWXv4TWXv4Aʄ!TW\5TW\5UWl:;!TWya@6TWya@6TWya@6Ҫp!TW|bq7TW|bq7TW|bq7共!TWڢ8TWڢ8TWڢ8j'yaTW9TW9VW+W!TW՗l:TW՗l:VW+)VaUWUWVW+LU!UW3UW3VW+#aUWHeUWHeVW+Rž!UWUWVW+VraUW6/UW6/VW+N2!UW:`UW:`VW+ׄaUWWUWWVW+ɇ-!UWZ)UWZ)VW+aUW^ZUW^ZVW+1h!UW{UW{VW+W[aUW< UW< VW+f!UW< UW< VW+ aUW~$ UW~$ VW+!UW~$ UW~$ VW+/[/aUW~$ UW~$ VW+|'!UW~$ UW~$ VW+aUW= UW= VW+ ]!UW= UW= VW+ aUW= UW= VW+ b3!UWU UWU VW+ I_aUWU UWU VW+ Tf!UWU UWU VW+ !aUWU UWU VW+ ` !UWU UWU VW+ D6aUWU UWU VW+ OzS!UWU UWU VW+ cS}aUWU UWU VW+Dc !UWU UWU VW+OvaUWԵ UWԵ VW 8ݩ!UWԵ UWԵ VW 5aUWԵ UWԵ VW _!UWԵ UWԵ VW j<aUWԵ UWԵ VW C²!UWԵ UWԵ VW G~aUWԵ UWԵ VW RTԚ!UWԵ UWԵ VW &2;aUWԵ UWԵ VW ڊ!UWԵ UWԵ VW RJaUWԵ UWԵ VW )!UWԵ UWԵ VW aUW UW VW \@!UW UW VW [taUW UW VW ['L!UW UW VW ˛aUW UW VW K0>!UW UW VW *aUW UW VW #!UW UW VW @H'aUWض UWض VW Oo!UWض UWض VW aUWض UWض VW L!UWr UWr VW MaUWr UWr VW Ux!UWr UWr VW ԑPaUWr UWr VW O!UWr UWr VW ԌXaUWr UWr VW bIX!UWr UWr VW }?aUWr UWr VW CU!UW۷PUW۷PVW 뛪aUW۷PUW۷PVW gW!UW۷PUW۷PVW aUW۷PUW۷PVW \!UW۷PUW۷PVW maUW۷PUW۷PVW ޸!UW۷PUW۷PVW 3aUW۷PUW۷PVW xo!UW۷PUW۷PVW ȁ4aUW۷PUW۷PVW 0$T!UW۷PUW۷PVW I_aUW۷PUW۷PVW K!UW۷PUW۷PVW ,;~aUWsUWsVW <!UWsUWsVW @aUWsUWsVW !UWsUWsVW  faUWsUWsVW 㟑!UWsUWsVW UaUWsUWsVW l!UWsUWsVW i*=aUW0UW0VW I~(?!UW0UW0VW :aUW0UW0VW z!UWtUWtVW ;ɒaUWtUWtVW `.!UWtUWtVW  aUWtUWtVW >>!UWtUWtVW  aUWtUWtVW Oݧ!UWtUWtVW aUWtUWtVW u!UW1UW1VW ѥzaUW1UW1VW  !UW1UW1VW H5!UW1UW1VW̛ Bu!UW1UW1VWxW =1DBuaUW1UW1VW :b!UW1UW1VW aHaUW1UW1VW 1!UW1UW1VW '!UW1UW1UW1?5S!UW1UW1UW1? ˦aUW1UW1VW ӻmX!UW5KUW5KVW :`aUW5KUW5KVW 7X]!UW5KUW5KVW 4daUW5KUW5KVW rL !UW8|UW8|VW  HuaUWUUWUVW n}!UWYFUWYFVW !UW]wUW]wUW]w<:!UW$UW$UW$=֜q!UW}iAUW}iAUW}iA"} !UWYUWYUWY"V!UW֞<UW֞<UW֞<4xg!UWڟmUWڟmVW f'!UWUWUW(TQ&!UW\7UW\7UW\7(r!UW3hUW3hUW3h(:\!UW7֙UW7֙UW7֙(mWWU lW޸(lW޸(c P( QY{PysŲ~:p'R/7ɻvkF#_kr& . ..MAKEDEVconsole tty memkmem-nullzerostdin-stdoutstderrksymsBklog- bpfbpf0Bwd0aBrwd0awd0bBrwd0b-wd0cBrwd0cBwd0d-rwd0d-wd0erwd0eBwd0f-rwd0fwd0gBrwd0g-wd0hrwd0hBwd0i- ... . .. binmdecZCsbine;Dshare; . ..encrypt ftpgrep-egrep-fgrep-gzip-gunzipgzcat-more-less- sed@signify ... .D ..ntermcap . ..MAKEDEVconsole tty memkmem-nullzerostdin-stdoutstderrksymsBklog- bpfbpf0Bwd0aBrwd0awd0bBrwd0b-wd0cBrwd0cBwd0d-rwd0d-wd0erwd0eBwd0f-rwd0fwd0gBrwd0g-wd0hrwd0hBwd0i-rwd0i-wd0jBrwd0j-wd0k rwd0k- wd0l- rwd0l- wd0m- rwd0m-wd0n-rwd0n-wd0o-rwd0o-wd0p-rwd0p-wd1a-rwd1a-wd1b-rwd1b-wd1c-rwd1c-wd1d-rwd1d-wd1e-rwd1e-wd1f-rwd1f- wd1g-!rwd1g-"wd1h-#rwd1h-$wd1i-#!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { : ${mklist[0]:=";mknod"} mklist[${#mklist[*]}]=" -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]="&& chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]="&& chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]="&& chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]="&& chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 wskbd0 apm bio diskmap random ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M klog c 6 0 600 ;; vscsi*) M vscsi$U c 100 $U 600 ;; video*) M video$U c 38 $U 600 MKlist[${#MKlist[*]}]=";[ -e video ] || ln -s video$U video" ;; uk*) M uk$U c 28 $U 640 operator ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; tap*) M tap$U c 104 $U 600 ;; tun*) M tun$U c 33 $U 600 ;; rmidi*) M rmidi$U c 57 $U 666 ;; *random) n=0 for pre in " " s u a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pppx*) M pppx$U c 103 $U 600 ;; pf*) M pf c 46 0 600 ;; hotplug) M hotplug c 37 $U 400 ;; fuse) M fuse$U c 77 $U 600 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; diskmap) M diskmap c 102 0 640 operator ;; bpf) M bpf c 22 0 600 M bpf0 c 22 0 600 ;; bktr*) M bktr$U c 75 $U 644 ;; bio) M bio c 52 0 600 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ugen2 ugen3 ugen4 ugen5 R ugen6 ugen7 ulpt0 ulpt1 uhid0 uhid1 uhid2 uhid3 usb0 usb1 R usb2 usb3 usb4 usb5 usb6 usb7 ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse[0-9]*) M wsmouse$U c 62 $U 600 ;; wskbd[0-9]*) M wskbd$U c 61 $U 600 ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 sd5 sd6 sd7 sd8 sd9 R cd0 cd1 rd0 tap0 tap1 tap2 tap3 tun0 tun1 tun2 tun3 pty0 bio R diskmap vscsi0 ch0 audio0 audio1 audio2 bpf fuse pppx R hotplug ptm local wscons uall rmidi0 rmidi1 rmidi2 rmidi3 R rmidi4 rmidi5 rmidi6 rmidi7 tuner0 radio0 video0 video1 uk0 R random tty00 tty01 tty02 tty03 tty04 tty05 tty06 tty07 tty08 R tty09 tty0a tty0b apm pf wd0 wd1 wd2 wd3 std st0 st1 fd ;; wd*|sd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi  . ..MAKEDEVconsole tty memkmem-nullzerostdin-stdoutstderrksymsBklog- bpfbpf0Bwd0aBrwd0awd0bBrwd0b-wd0cBrwd0cBwd0d-rwd0d-wd0erwd0eBwd0f-rwd0fwd0gBrwd0g-wd0hrwd0hBwd0i-rwd0i-wd0jBrwd0j-wd0k rwd0k- wd0l- rwd0l- wd0m- rwd0m-wd0n-rwd0n-wd0o-rwd0o-wd0p-rwd0p-wd1a-rwd1a-wd1b-rwd1b-wd1c-rwd1c-wd1d-rwd1d-wd1e-rwd1e-wd1f-rwd1f- wd1g-!rwd1g-"wd1h-#rwd1h-$wd1i-%rwd1i-&wd1j'rwd1j-(wd1k)rwd1kB*wd1l-+rwd1l-,wd1m--rwd1m-.wd1n-/rwd1n-0wd1o-1rwd1o-2wd1p-3rwd1p-4sd0a-5rsd0a-6sd0b-7rsd0b-8sd0c-9rsd0c-:sd0d-;rsd0d-<sd0e-=rsd0e->sd0f-?rsd0f-@sd0g-Arsd0g-Bsd0h-Crsd0h-Dsd0i- . ..MAKEDEVconsole tty memkmem-nullzerostdin-stdoutstderrksymsBklog- bpfbpf0Bwd0aBrwd0awd0bBrwd0b-wd0cBrwd0cBwd0d-rwd0d-wd0erwd0eBwd0f-rwd0fwd0gBrwd0g-wd0hrwd0hBwd0i-rwd0i-wd0jBrwd0j-wd0k rwd0k- wd0l- rwd0l- wd0m- rwd0m-wd0n-rwd0n-wd0o-rwd0o-wd0p-rwd0p-wd1a-rwd1a-wd1b-rwd1b-wd1c-rwd1c-wd1d-rwd1d-wd1e-rwd1e-wd1f-rwd1f- wd1g-!rwd1g-"wd1h-#rwd1h-$wd1i-%rwd1i-&wd1j'rwd1j-(wd1k)rwd1kB*wd1l-+rwd1l-,wd1m--rwd1m-.wd1n-/rwd1n-0wd1o-1rwd1o-2wd1p-3rwd1p-4sd0a-5rsd0a-6sd0b-7rsd0b-8sd0c-9rsd0c-:sd0d-;rsd0d-<sd0e-=rsd0e->sd0f-?rsd0f-@sd0g-Arsd0g-Bsd0h-Crsd0h-Dsd0i-Ersd0i-Fsd0j-Grsd0jHsd0k-Irsd0k-Jsd0l-Krsd0l-Lsd0m-Mrsd0m-Nsd0n-Orsd0n-Psd0o-Qrsd0o-Rsd0p-Srsd0p-Ttty00-Ucua00-Vrd0a-Wrrd0a-Xrd0c-Yrrd0c-Zwsmouse[wskbd-\ st0]rst0-^nst0-_nrst0-`est0-aerst0benst0cenrst0dttyC0ewskbd0f apmgapmctlh bioidiskmapjrandomksrandomlurandommarandom dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :5i:am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:\ :cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :eA=\E)0:ec=\E[%dX:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1l\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:\ :kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:\ :l4=pf4:le=^H:mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:\ :nw=\EE:pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :u6=\E[%i%d;%dR:u7=\E[6n:u9=\E[c:ue=\E[24m:up=\E[A:\ :us=\E[4m:vb=\E[?5h\E[?5l: #!/bin/ksh usage() { echo "usage: ${0##*/} [-a] [-f filename] [-m install | upgrade]" >&2 exit 1 } waitcgiinfo() { local _l _key _val wait "$CGIPID" 2>/dev/null [[ -s $CGI_INFO ]] || return sed -n 's,^http://\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $CGI_INFO >$HTTP_LIST 2>/dev/null read -r -- _l <$HTTP_LIST : ${HTTP_SERVER:=${_l%%/*}} while IFS='=' read -r -- _key _val; do case $_key=$_val in method=+([a-z])) CGI_METHOD=$_val;; TIME=+([0-9])) CGI_TIME=$_val;; TZ=+([-_/+[:alnum:]])) CGI_TZ=$_val;; esac done <$CGI_INFO } bsort() { local _a=$1 _b _l (($#)) && shift || return for _b; do [[ $_a == "$_b" ]] && continue if [[ $_a > $_b ]]; then _l="$_a $_l" _a=$_b else _l="$_b $_l" fi done echo -n "$_a " bsort $_l } isin() { local _a=$1 _b shift for _b; do [[ $_a == "$_b" ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } http_time() { local _sec=$(cat $HTTP_SEC 2>/dev/null) [[ -n $_sec && -n $CGI_TIME ]] && echo $((CGI_TIME + SECONDS - _sec)) } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) showcols() { local _l _cdir=/tmp/cdir _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [[ -n $_l ]] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } stripcom () { local _l [[ -f $1 ]] || return set -o noglob while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 set +o noglob } tmpdir() { local _i=1 _dir until _dir="${1?}.$_i.$RANDOM" && mkdir -- "$_dir" 2>/dev/null; do ((++_i < 10000)) || return 1 done echo "$_dir" } unique_filename() { local _fn=$1 _ufn while _ufn=${_fn}.$RANDOM && [[ -e $_ufn ]]; do done print -- "$_ufn" } prep_root_mail() { local _fn=$1 _subject=$2 _ufn [[ -s $_fn ]] || return _ufn=$(unique_filename /mnt/var/log/${_fn##*/}) cp $_fn $_ufn chmod 600 $_ufn _ufn=${_ufn#/mnt} cat <<__EOT >>/mnt/etc/rc.firsttime ( /usr/bin/mail -s '$_subject' root <$_ufn && rm $_ufn ) >/dev/null 2>&1 & __EOT } lease_value () { local _lf=$1 _o shift for _o; do sed -E \ -e '/^ *(option )?'"$_o"' (.*);$/!d;s//\2/' \ -e '/^"(.*)"$/{s//\1/;s/\\(.)/\1/g;};q' "$_lf" \ | grep ^ && return done } diskinfo() { local _d for _d; do makedev $_d echo -n "$_d: " disklabel -dpg $_d 2>/dev/null | sed -e '/^label: /{s,,,;s/ *$//;s/^$//;h;d;}' \ -e '/.*# total bytes: \(.*\)/{s//(\1)/;H;}' \ -e '$!d;x;s/\n/ /' rm -f /dev/{r,}$_d? done } makedev() { [[ -z $(cd /dev && sh MAKEDEV "$@" 2>&1) ]] } scan_dmesg() { bsort $(sed -n "$1" /var/run/dmesg.boot) } scan_disknames() { local IFS=, bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -n "$1") } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_dkdevs_uninitialized() { local _disks=$(get_dkdevs) _d for _d in $DISKS_DONE; do _disks=$(rmel "$_d" $_disks) done bsort $_disks } get_ifs() { local _if _iflist=$(rmel vlan $(ifconfig -C)) for _if in $(ifconfig "$@" 2>/dev/null | sed -n 's/^\([^[:space:]]*\):.*/\1/p'); do isin "${_if%%+([0-9])}" $_iflist || echo $_if done } get_dkdev_name() { local _dev=${1#/dev/} _d _dev=${_dev%.[a-p]} ((${#_dev} < 16)) && _dev=${_dev%[a-p]} local IFS=, for _d in $(sysctl -n hw.disknames); do [[ $_dev == @(${_d%:*}|${_d#*:}) ]] && echo ${_d%:*} && break done } disk_has() { local _disk=$1 _pttype=$2 _part=$3 _cmd _p_pttype _p_part [[ -n $_disk && -n $_pttype ]] || exit local _c_hfs="pdisk -l $_disk" local _c_sr="bioctl -q $_disk" local _p_gpt='Usable LBA:' local _p_gpt_openbsd='^[ *]...: OpenBSD ' local _p_gpt_efisys='^[ *]...: EFI Sys ' local _p_hfs='^Partition map ' local _p_hfs_openbsd=' OpenBSD OpenBSD ' local _p_mbr='Signature: 0xAA55' local _p_mbr_openbsd='^..: A6 ' local _p_mbr_dos='^..: 06 ' local _p_mbr_dos_active='^\*.: 06 ' local _p_mbr_linux='^..: 83 ' local _p_sr='OPENBSD, SR' local _p_sr_crypto='OPENBSD, SR CRYPTO' eval "_cmd=\"\$_c_${_pttype}\"" eval "_p_pttype=\"\$_p_${_pttype}\"" eval "_p_part=\"\$_p_${_pttype}_${_part}\"" _cmd=${_cmd:-fdisk $_disk} [[ -z $_p_pttype ]] && exit [[ -n $_part && -z $_p_part ]] && exit if [[ -z $_p_part ]]; then $_cmd 2>/dev/null | grep -Eq "$_p_pttype" else $_cmd 2>/dev/null | grep -Eq "$_p_pttype" && $_cmd 2>/dev/null | grep -Eq "$_p_part" fi } disklabel_autolayout() { local _disk=$1 _f=$2 _dl=/disklabel.auto _op [[ $_disk != $ROOTDISK ]] && return while $AUTO; do ask "URL to autopartitioning template for disklabel?" none [[ $resp == none ]] && break echo "Fetching $resp" if ftp -Vo $_dl "$resp" && [[ -s $_dl ]]; then disklabel -T $_dl -F $_f -w -A $_disk && return echo "Autopartitioning failed" exit 1 else echo "No autopartitioning template found." exit 1 fi done while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in [aA]*) _op=-w;; [eE]*) _op=-E;; [cC]*) return 0;; *) continue;; esac disklabel -F $_f $_op -A $_disk return done } configure_disk() { local _disk=$1 _fstab=/tmp/fstab.$1 makedev $_disk || return rm -f /tmp/*.$_disk md_prep_disklabel $_disk || return if ! grep -qs ' / ffs ' /tmp/fstab.$ROOTDISK; then echo "'/' must be configured!" return 1 fi if [[ -f $_fstab ]]; then while read _pp _mp _rest; do if [[ $_mp == none ]]; then echo "$_pp $_mp $_rest" >>/tmp/fstab continue fi if [[ $_fstab != $(grep -l " $_mp " /tmp/fstab.*) ]]; then _rest=$_disk _disk= break fi done <$_fstab if [[ -z $_disk ]]; then cat /tmp/fstab.$_rest >/etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." return 1 fi while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} FSENT="$FSENT $_mp!$_pp" done <$_fstab fi return 0 } lock() { while ! mkdir /tmp/lock 2>/dev/null && sleep .1; do done } unlock() { rm -d /tmp/lock 2>/dev/null } retrap() { trap 'kill -KILL $CPPID 2>/dev/null; echo; stty echo; exit 0' \ INT EXIT TERM } log_answers() { if [[ -n $1 && -n $2 ]]; then print -r -- "${1%%'?'*} = $2" >>/tmp/$MODE.resp fi } get_responsefile() { local _rf _if _mac _mode _lf _hn _path _aifile AI_MODE= [[ -f /auto_upgrade.conf ]] && _rf=/auto_upgrade.conf _mode=upgrade [[ -f /auto_install.conf ]] && _rf=/auto_install.conf _mode=install [[ -f $_rf ]] && cp $_rf /ai.$_mode.conf && AI_MODE=$_mode && return for _if in ''; do [[ -x /sbin/dhclient ]] || break set -- $(get_ifs netboot) (($# == 0)) && set -- $(get_ifs) (($# == 1)) && _if=$1 while (($# > 1)); do ask_which "network interface" \ "should be used for the initial DHCP request" "$*" isin "$resp" $* && _if=$resp && break done [[ -n $_if ]] && dhclient $_if || break _lf=/var/db/dhclient.leases.$_if _aifile=$(lease_value $_lf filename bootfile-name) [[ $_aifile == ?(*/)auto_@(install|upgrade) ]] || _aifile= _path=${_aifile%auto_@(install|upgrade)} _mode=${_aifile##*?(/)auto_} AI_SERVER=$(lease_value $_lf server-name tftp-server-name next-server) export AI_SERVER _hn=$(lease_value $_lf host-name) hostname "$_hn" done if [[ -n $AI_SERVER && -n $_mode ]]; then _mac=$(ifconfig $_if | sed 's/.*lladdr \(.*\)/\1/p;d') for _rf in {$_mac-,${_hn:+$_hn-,}}$_mode; do _url="http://$AI_SERVER/$_path$_rf.conf?path=$HTTP_SETDIR" echo "Fetching $_url" if ftp -Vo "/ai.$_mode.conf" "$_url" 2>/dev/null; then AI_MODE=$_mode ifconfig $_if delete down 2>/dev/null return 0 fi done else [[ -z $AI_SERVER ]] && echo "Could not determine auto server." [[ -z $_mode ]] && echo "Could not determine auto mode." fi while :; do ask "Response file location?" \ "${AI_SERVER:+http://$AI_SERVER/install.conf}" [[ -n $resp ]] && _rf=$resp && break done _mode=$(echo "$_rf" | sed -En 's/^.*(install|upgrade).conf$/\1/p') while [[ -z $_mode ]]; do ask "(I)nstall or (U)pgrade?" [[ $resp == [iI]* ]] && _mode=install [[ $resp == [uU]* ]] && _mode=upgrade done echo "Fetching $_rf" [[ -f $_rf ]] && _rf="file://$_rf" ftp -Vo "/ai.$_mode.conf" "$_rf" 2>/dev/null && AI_MODE=$_mode ifconfig $_if delete down 2>/dev/null [[ -n $AI_MODE ]] } _autorespond() { typeset -l _q=$1 _key local _def=$2 _l _val [[ -f $RESPFILE ]] || return mv /ai.conf /ai.conf.tmp while IFS=' ' read -r _l; do [[ $_l == [!#=]*=?* ]] || continue _key=${_l%%*([[:blank:]])=*} _val=${_l##*([!=])=*([[:blank:]])} [[ $_q == @(|*[[:blank:]])"$_key"@([[:blank:]?]*|) ]] && resp=$_val && cat && return print -r " $_l" done /ai.conf [[ -n $_def ]] && resp=$_def && return echo "\nQuestion has no answer in response file." exit 1 } _ask() { local _q=$1 _def=$2 _int _redo=0 _pid lock; dmesg >/tmp/update; unlock echo -n "${_q:+$_q }${_def:+[$_def] }" _autorespond "$_q" "$_def" && echo "$resp" && return trap "_int=1" INT trap "_redo=1" TERM read resp lock; rm /tmp/update; unlock if ((_redo)); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap ((_int)) && kill -INT $$ : ${resp:=$_def} return $_redo } ask() { while ! _ask "$1" "$2"; do done log_answers "$1" "$resp" } ask_yn() { local _q=$1 _a=${2:-no} typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y; return 0;; n|no) resp=n; return 1;; esac echo "'$resp' is not a valid choice." $AUTO && exit 1 done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef _key _q _key=$(echo "$_name" | sed 's/[^[:alnum:]]/_/g') while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (($# < 1)) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." _q="Which $_name $_query?" echo -n "$_q (or 'done') ${_dyndef:+[$_dyndef] }" _autorespond "$_q" "${_dyndef-done}" && echo "$resp" \ || _ask || continue [[ -z $resp ]] && resp="$_dyndef" if isin "$resp" $_dynlist done; then log_answers "$_q" "$resp" break fi echo "'$resp' is not a valid choice." $AUTO && [[ -n $RESPFILE ]] && exit 1 done } function ask_until { resp= while true; do ask "$1" "$2" [[ -n $resp ]] && break echo "A response is required." $AUTO && exit 1 done } askpass() { stty -echo IFS= read -r resp?"$1 " stty echo echo } askpassword() { local _q=$1 if $AUTO; then echo -n "$_q " _autorespond "$_q" echo '' _password=$resp return fi while :; do askpass "$_q (will not echo)" _password=$resp askpass "$_q (again)" [[ $resp == "$_password" ]] && break echo "Passwords do not match, try again." done } dhcp_request() { local _if=$1 _hn=$2 echo "lookup file bind" >/etc/resolv.conf.tail echo "send host-name \"$_hn\";" >/etc/dhclient.conf ifconfig $_if group dhcp >/dev/null 2>&1 dhclient -c /dev/stdin $_if <<__EOT initial-interval 1; backoff-cutoff 2; reboot 5; timeout 10; send host-name "$_hn"; __EOT mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/dev/null echo "$_addr $_name" >>/tmp/hosts } v4_config() { local _if=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_if | grep -q 'groups:.* dhcp'; then _addr=dhcp else set -- $(v4_info $_if) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_if inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_if? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." else dhcp_request $_if "$_name" echo "dhcp" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask for $_if?" "${_mask:=255.255.255.0}" ifconfig $_if -group dhcp >/dev/null 2>&1 if ifconfig $_if inet $_addr netmask $resp up; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_info() { ifconfig $1 inet6 | sed -n ' 1s/.*/dev/null | sed -n '/bytes from/{s/^.*from //;s/,.*$//;p;}' | sed -n 'G;s/\n/&&/;/^\(.*\n\).*\n\1/d;h;P')) _prompt="IPv6 default router?" if $AUTO; then _autorespond "$_prompt" && _resp=$resp && echo "$_prompt $_resp" else local PS3="$_prompt (${_routers:+list #, }IPv6 address or 'none'): " select _resp in $_routers; do [[ ${_resp:=$REPLY} == *:* ]] && break [[ $_resp == none ]] && return done fi route -n add -inet6 -host default "$_resp" && echo "$_resp" >>/tmp/mygate } v6_config() { local _if=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_if) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } ifconfig $_if inet6 >/dev/null 2>&1 && _prompt="or 'rtsol' " _prompt="IPv6 address for $_if? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) ifconfig $_if inet6 >/dev/null 2>&1 || { echo "No INET6 support."; return; } ifconfig $_if up ifconfig $_if inet6 autoconf && echo "up\nrtsol" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_if?" "${_prefixlen:=64}" ifconfig $_if inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_if } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' >$WLANLIST cat $WLANLIST } ieee80211_config() { local _if=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_if -nwid -nwkey ifconfig $_if -wpa 2>/dev/null && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_if | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_if | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | cat -n | more -c ;; *) _nwid=$resp ;; esac done if [[ $_nwid != any ]]; then ifconfig $_if nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" ((_haswpa == 1)) && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_if nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_if wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } configure_ifs() { local _first _ifs _if _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(*vlan: +([[:digit:]]) parent interface:*) ]] || break ((_vl++)) done _vd= ifconfig lo0 inet 127.0.0.1/8 rm -f /tmp/mygate while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifs)' \ ${_p:-'$( (get_ifs netboot; get_ifs) | sed q )'} [[ $resp == done ]] && break _if=$resp _hn=/tmp/hostname.$_if rm -f $_hn if [[ $_if == vlan+([0-9]) ]]; then _vi=$(ifconfig $_if 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while ((++_vi < 4096)); do ! isin "$_vi" $_tags && break done fi _ifs=$(get_ifs) set -- $_ifs while [[ $1 == vlan+([0-9]) ]]; do shift done ask "Which interface:tag should $_if be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifs && [[ $_vd != vlan+([0-9]) ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if ((_vi < 1 || _vi > 4095)) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || echo "up" >>/tmp/hostname.$_vd chmod 640 /tmp/hostname.$_vd ifconfig $_vd up ifconfig $_if destroy >/dev/null 2>&1 ifconfig $_if vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_if##vlan} == $_vl ]] && ((_vl++)) fi ifconfig $_if 2>/dev/null | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_if $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_if ]] && ask "Symbolic (host) name for $_if?" $resp _name=$resp v4_config $_if $_name $_hn v6_config $_if $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn : ${_first:=$_if} fi NIFS=$(ls -1 /tmp/hostname.* 2>/dev/null | grep -c ^) _p=done done } v4_defroute() { local _dr [[ -n $(ifconfig | sed -n '/[ ]inet .* broadcast /p') ]] || return set -- $(route -nv show -inet | { set -- $(grep '^default '); print $2 $9; }) [[ -n $1 ]] && _dr=$1 [[ -n $_dr && $2 == DHCLIENT && -f /tmp/dhclient.conf ]] && return while :; do ask_until "Default IPv4 route? (IPv4 address or none)" "$_dr" [[ $resp == none ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >>/tmp/mygate; break; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } get_fqdn() { local _dn _dn=$(hostname) _dn=${_dn#$(hostname -s)} _dn=${_dn#.} echo "${_dn:=my.domain}" } sane_install() { local _q=$1 _s for _s in $SANESETS; do isin "$_s" $DEFAULTSETS || continue [[ -n $_q ]] && return 1 if ! ask_yn "Are you *SURE* your $MODE is complete without '$_s'?"; then $AUTO && exit 1 || return 1 fi done } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin "$_f" $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2;; done) break 2;; -*) _action=rmel;; *) _action=addel;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done done set +o noglob COLUMNS=$_col resp=$_selected } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS \ _tmpfs _tmpsrc _cfile _fsrc _unver _t _issue _srclocal for _f in $THESETS; do isin "$_f" $_files || continue _sets=$(addel $_f $_sets) isin "$_f" $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at $_src " echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col $AUTO && exit 1 echo return fi isin "INSTALL.$ARCH" $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" || return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp _get_sets=$(for s in $THESETS; do isin "$s" $_get_sets && echo $s; done) _unver=$_get_sets for _issue in ''; do ! isin SHA256.sig $_files && _issue="Directory does not contain SHA256.sig" && break _tmpfs=$( ( for fs in /mnt/{{,var/}tmp,home,usr{/local,}}; do df -k $fs 2>/dev/null | grep " $fs\$" done df -k ) | ( while read a a a a m m; do [[ $m == /mnt/@(@(|var/)tmp|home|usr/@(src,obj,xobj))@(|/*) ]] && ((a > 524288)) && echo $m && exit [[ $m == /mnt@(|/*) ]] && ((a > 524288 * 4)) && echo $m && exit done ) ) if [[ -d $_tmpfs ]]; then ! _tmpsrc=$(tmpdir "$_tmpfs/sets") && _issue="Cannot create prefetch area" && break else _issue="Cannot determine prefetch area" && break fi _cfile=$_tmpsrc/SHA256 _srclocal=false _t=Get/Verify [[ $_src == file://* ]] && _srclocal=true _t='Verifying ' ! ftp -D "$_t" -Vmo "$_cfile.sig" "$_src/SHA256.sig" && _issue="Cannot fetch SHA256.sig" && break ! signify -Vep /etc/signify/openbsd-${VERSION}-base.pub \ -x "$_cfile.sig" -m "$_cfile" && _issue="Signature check of SHA256.sig failed" && break for _f in $_get_sets; do rm -f "$_tmpsrc/h" "$_tmpsrc/fail" ( ftp -D "$_t" -Vmo - "$_src/$_f" || >"$_tmpsrc/fail" ) | ( $_srclocal && sha256 >$_tmpsrc/h || sha256 -ph "$_tmpsrc/h" >"$_tmpsrc/$_f" ) if [[ -f $_tmpsrc/fail ]]; then rm -f "$_tmpsrc/$_f" if ! ask_yn "Fetching of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi continue fi if fgrep -qx "SHA256 ($_f) = $(<$_tmpsrc/h)" "$_cfile"; then _unver=$(rmel $_f $_unver) else if ! ask_yn "Checksum test for $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi fi done done [[ -n $_unver ]] && : ${_issue:="Unverified sets:" ${_unver% }} if [[ -n $_issue ]] && ! ask_yn "$_issue. Continue without verification?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi for _f in $_get_sets; do _fsrc="$_src/$_f" [[ -f $_tmpsrc/$_f ]] && _fsrc="file://$_tmpsrc/$_f" case $_fsrc in *.tgz) ftp -D Installing -Vmo - "$_fsrc" | tar -zxphf - -C /mnt if [[ $_f == ?(x)base*.tgz && $MODE == install ]]; then ftp -D Extracting -Vmo - \ file:///mnt/var/sysmerge/${_f%%base*}etc.tgz | tar -zxphf - -C /mnt fi ;; *) ftp -D Installing -Vmo "/mnt/$_f" "$_fsrc" ;; esac if (($?)); then if ! ask_yn "Installation of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi [[ -d $_tmpsrc ]] && rm -f "$_tmpsrc/$_f" done [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" } install_http() { local _file_list _prompt _mirror _url_base waitcgiinfo ask "HTTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${http_proxy:-none}" unset http_proxy [[ $resp == none ]] || export http_proxy=$resp if [[ -s $HTTP_LIST ]]; then _prompt="HTTP Server? (hostname, list#, 'done' or '?')" else echo "(Unable to get list from ftp.openbsd.org, but that is OK)" _prompt="HTTP Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$HTTP_SERVER" case $resp in done) return ;; "?") [[ -s $HTTP_LIST ]] || continue cat -n < $HTTP_LIST | more -c ;; +([0-9])) [[ -s $HTTP_LIST ]] || continue set -- $(sed -n "${resp}p" $HTTP_LIST) (($# < 1)) && { echo "There is no line $resp."; continue; } HTTP_SERVER=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) HTTP_SERVER=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done set -- $(sed "/^$HTTP_SERVER/x;\$!d;x" $HTTP_LIST 2>/dev/null) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (($# > 1)); then resp=$resp/$HTTP_SETDIR _mirror=yes fi : ${HTTP_DIR:=pub/OpenBSD/$HTTP_SETDIR} ask_until "Server directory?" "${resp:-$HTTP_DIR}" HTTP_DIR=$resp _url_base="http://$HTTP_SERVER/$HTTP_DIR" _file_list=$(ftp -Vo - "$_url_base/index.txt" | sed 's/^.* //;s/ //') install_files "$_url_base" "$_file_list" INSTALL_URL=$_url_base PACKAGE_PATH= if [[ -n $_mirror ]]; then PACKAGE_PATH=$(print -r -- "$_url_base" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/\1/packages/$(arch -s)/!;q") fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp; break; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp; break; } [[ -d /$resp ]] && { _dir=/$resp; break; } echo "The directory '$resp' does not exist." $AUTO && exit 1 done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { local _drive=$1 makedev $_drive && mount_mnt2 $_drive || return install_mounted_fs } install_disk() { if ! ask_yn "Is the disk partition already mounted?"; then ask_which "disk" "contains the $MODE media" \ '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' [[ $resp == done ]] && return 1 makedev $resp && mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | sed -En '/swap|unused/d;/^ [a-p]: /p' >$_file _parts=$(sed 's/^ \(.\): .*/\1/' $_file) set -- $_parts (($# == 0)) && { echo "No filesystems found on $_dev."; return 1; } if isin "c" $_parts; then resp=c elif (($# == 1)); then resp=$1 else cat $_file ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | sed -En '\''/swap|unused/d;/^ ([a-p]): .*/s//\1/p'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in [lL\?]) echo "Available layouts: $_layouts";; default) return;; *) kbd $resp && { echo $resp >/tmp/kbdtype; return; };; esac done fi } donetconfig() { local _dn _ns _f1 _f2 _f3 configure_ifs v4_defroute if [[ -f /tmp/resolv.conf.shadow ]]; then mv /tmp/resolv.conf.shadow /tmp/resolv.conf while read -r -- _f1 _f2 _f3; do [[ $_f1 == nameserver ]] && _ns="${_ns:+$_ns }$_f2" [[ $_f1 == @(domain|search) ]] && _dn=$_f2 done /dev/null 2>&1 && [[ $NIFS == 1 && -n $_dn ]]; then echo "Using DNS domainname $resp" else ask "DNS domain name? (e.g. 'bar.com')" "$resp" fi hostname "$(hostname -s).$resp" resp="${_ns:=none}" if ifconfig dhcp >/dev/null 2>&1 && [[ $NIFS == 1 && -n $_ns ]]; then echo "Using DNS nameservers at $resp" else ask "DNS nameservers? (IP address list or 'none')" "$resp" fi if [[ $resp != none ]]; then echo "lookup file bind" >/tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi } questions() { local _d _cdef=no ask_yn "Start sshd(8) by default?" yes sshd=$resp aperture= resp= xdm= if [[ -n $DISPLAY ]]; then if [[ -n $(scan_dmesg '/^[a-z]*[01]: aperture needed/p') ]]; then ask_yn "Do you expect to run the X Window System?" yes && aperture=$MDXAPERTURE fi if [[ -n $MDXDM && $resp != n ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} [[ -n $CONSOLE ]] && _cdef=yes ask_yn "Change the default console to $_d?" $_cdef defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n;; *) CSPEED=$resp;; esac fi fi } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return ;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue ;; root|daemon|operator|bin|sshd|uucp|www|nobody|ftp) ;; [a-z]*([a-z0-9_])) ((${#resp} <= 31)) && break ;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full name for user $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed." ;; *) ((${#resp} <= 100)) && break echo "Too long." ;; esac done username=$resp askpassword "Password for user $user?" userpass=$_password userkey= $AUTO && ask "Public ssh key for user $user" none && [[ $resp != none ]] && userkey=$resp } ask_root_sshd() { typeset -l _resp [[ $sshd == y ]] || return if [[ -z $user ]]; then echo "Since no user was setup, root logins via sshd(8) might be useful." fi echo "WARNING: root is targeted by password guessing attacks, pubkeys are safer." while :; do ask "Allow root ssh login? (yes, no, prohibit-password)" no _resp=$resp case $_resp in y|yes) sshd_enableroot=yes ;; n|no) sshd_enableroot=no ;; w|p|without-password|prohibit-password) sshd_enableroot=prohibit-password ;; *) echo "'$resp' is not a valid choice." $AUTO && exit 1 continue ;; esac break done } set_timezone() { local _zonefile=$1 _zonepath _zsed _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitcgiinfo isin "$CGI_TZ" $(<$_zonefile) && TZ=$CGI_TZ [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue ;; "?") grep -v /. $_zonefile | showcols continue ;; esac while isin "$_zonepath/" $(<$_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols;; *) _zonepath=$_zonepath/$resp;; esac done if isin "$_zonepath" $(<$_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } get_rootinfo() { while :; do echo "Available disks are: $(get_dkdevs | sed 's/^$/none/')." _ask "Which disk is the root disk? ('?' for details)" \ $(get_dkdevs | sed 's/ .*//') || continue case $resp in "?") diskinfo $(get_dkdevs) ;; '') ;; *) isin "$resp" $(get_dkdevs) && break echo "no such disk" ;; esac done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b } ifstart () { local _hn=$1 if=${1#/mnt/etc/hostname.} ((NIFS++)) while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1 while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case "$af" in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" if [[ -x /sbin/dhclient ]]; then cmd="$cmd; dhclient $if" else cmd="$cmd; echo /sbin/dhclient missing - skipping dhcp request." fi ;; "rtsol") if ifconfig $if inet6 >/dev/null 2>&1; then rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" else cmd="$cmd; echo no INET6 support - skipping rtsol request." fi ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name" case "$dt" in dest) cmd="$cmd $dtaddr" ;; *) cmd2="$dt $dtaddr" ;; esac case $af in inet) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet alone is invalid" return fi [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a X"$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd=";route -qn add -host $name 127.0.0.1" ;; inet6) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet6 alone is invalid" return fi [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done <$_hn } enable_network() { local _f _gw _trunks _svlans _vlans for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [[ -f /mnt/etc/$_f ]]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} if isin "${if%%+([0-9])}" $(ifconfig -C); then case ${if%%+([0-9])} in trunk) _trunks="$_trunks $hn";; svlan) _svlans="$_svlans $hn";; vlan) _vlans="$_vlans $hn";; esac else ifconfig $if >/dev/null 2>&1 && ifstart $hn fi done for hn in $_trunks $_svlans $_vlans; do ifstart $hn done [[ -n $rtsolif ]] && ifconfig $rtsolif inet6 autoconf [[ -z $dhcpif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == @(*:*) ]] && continue route -qn delete default >/dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } startcgiinfo() { ((NIFS < 1)) && return set -m ( ftp -Vao - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$HTTP_SETDIR" \ 2>/dev/null >$CGI_INFO echo -n $SECONDS >$HTTP_SEC feed_random ) & CGIPID=$! set +m (sleep 12; kill -INT -$CGIPID >/dev/null 2>&1) & } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/vnd*|\#*) || $_fstype == nfs || ! -f /sbin/mount_$_fstype || $_opt == *noauto* || $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed 's/softdep//') if [[ $_fstype == ffs ]]; then _opt=$(echo $_opt | sed 's/[[:<:]]ro[[:>:]]/rw/') else _opt=$(echo $_opt | sed 's/[[:<:]]rw[[:>:]]/ro/') fi echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [[ ! -s /etc/fstab ]]; then echo "Unable to create valid /etc/fstab." exit fi } check_fs() { local _dev _dn _mp _fstype _rest _fail _f _passno ask_yn "Force checking of clean non-root filesystems?" && _f=f while read _dev _mp _fstype _rest _rest _passno _rest; do _dn=$(get_dkdev_name "$_dev") [[ $ROOTDEV == @(${_dev#/dev/}|$_dn${_dev##*.}) ]] && continue [[ -f /sbin/fsck_$_fstype ]] || continue makedev "$_dn" || continue ((_passno > 0)) || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /dev/random 2>&1 if [[ -e /mnt/var/db/host.random ]]; then dd if=/mnt/var/db/host.random of=/dev/random bs=65536 count=1 \ status=none fi } install_sets() { local _cddevs=$(get_cddevs) _d=$CGI_METHOD _locs="disk http" _src echo ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $_cddevs ]] && : ${_d:=cd0} [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" : ${_d:=http} if ! isin "$_d" $_cddevs $_locs; then for _src in http $_cddevs nfs disk; do isin "$_src" $_cddevs $_locs && _d=$_src && break done fi echo "Let's $MODE the sets!" while :; do _cddevs=$(get_cddevs) umount -f /mnt2 >/dev/null 2>&1 ask "Location of sets? (${_cddevs:+$_cddevs }$_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; [cC]*) if [[ -n $_cddevs ]]; then set -- $_cddevs [[ $resp == [cC]?([dD]) ]] && resp=$1 install_cdrom $resp && INSTALL_METHOD=$resp fi ;; [dD]*) install_disk && INSTALL_METHOD=disk ;; [hH]*) isin http $_locs && install_http && INSTALL_METHOD=http ;; [nN]*) isin nfs $_locs && install_nfs && INSTALL_METHOD=nfs ;; *) $AUTO && echo "'$resp' is not a valid choice." && exit 1 ;; esac [[ -n $INSTALL_METHOD ]] && _d=$INSTALL_METHOD sane_install quiet || $AUTO && _d=done done } apply() { if [[ $sshd == n ]]; then echo "sshd_flags=NO" >>/mnt/etc/rc.conf.local elif [[ -n $sshd_enableroot ]]; then if ! grep -q "^#PermitRootLogin $sshd_enableroot\$" \ /mnt/etc/ssh/sshd_config; then sed -i "s/^#\(PermitRootLogin\) .*/\1 $sshd_enableroot/" \ /mnt/etc/ssh/sshd_config fi fi [[ -n $aperture ]] && echo "machdep.allowaperture=$aperture # See xf86(4)" \ >>/mnt/etc/sysctl.conf [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]] && echo "xdm_flags=" >>/mnt/etc/rc.conf.local if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } encr_pwd() { local _p=$1 if [[ -z $_p ]]; then echo '*' elif [[ $_p == \$2?\$[0-9][0-9]\$* && ${#_p} > 40 || $_p == '*************' ]]; then echo "$_p" else encrypt -b a -- "$_p" fi } store_random() { dd if=/dev/random of=/mnt/var/db/host.random bs=65536 count=1 \ status=none dd if=/dev/random of=/mnt/etc/random.seed bs=512 count=1 status=none chmod 600 /mnt/var/db/host.random /mnt/etc/random.seed } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done $/\1/p') md_installboot $ROOTDISK if [[ -f /mnt/bsd.mp ]] && ((NCPU > 1)); then echo "Multiprocessor machine; using bsd.mp instead of bsd." mv /mnt/bsd /mnt/bsd.sp 2>/dev/null mv /mnt/bsd.mp /mnt/bsd fi [[ $MODE == upgrade ]] && echo "/usr/sbin/sysmerge -b" >>/mnt/etc/rc.sysmerge echo "/usr/sbin/fw_update -v" >>/mnt/etc/rc.firsttime prep_root_mail /tmp/$MODE.resp "$(hostname) $MODE response file" store_random cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter 'reboot' at the command prompt. __EOT [[ $MODE == install ]] && cat <<__EOT When you login to your new system the first time, please read your mail using the 'mail' command. __EOT md_congrats $AUTO && >/ai.done } do_install(){ ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname "$resp" THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig ((NIFS)) && startcgiinfo echo while :; do askpassword "Password for root account?" _rootpass="$_password" [[ -n "$_password" ]] && break echo "The root password must be set." done rootkey= if $AUTO; then ask "Public ssh key for root account?" none [[ $resp != none ]] && rootkey=$resp fi questions user_setup ask_root_sshd set_timezone /var/tzlist echo get_rootinfo DISKS_DONE= FSENT= rm -f /tmp/fstab* while :; do if ! isin "$ROOTDISK" $DISKS_DONE; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(get_dkdevs_uninitialized)' done [[ $resp == done ]] && break fi _disk=$resp configure_disk $_disk || continue DISKS_DONE=$(addel $_disk $DISKS_DONE) done for _mp in $(bsort $FSENT); do _pp=${_mp##*!} _mp=${_mp%!*} echo -n "$_pp $_mp ffs rw" [[ $_mp == / ]] && { echo " 1 1"; continue; } echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" done >>/tmp/fstab munge_fstab mount_fs "-o async" feed_random install_sets _mp=$(df /mnt/usr/local | sed '$!d') _mp=${_mp##*/mnt} sed -i "s#\(${_mp:-/} ffs rw\)#\1,wxallowed#" /tmp/fstab if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF $(tar cvf /dev/null [A-Za-y]*) >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(http_time) && _now=$(date +%s) && (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ if ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(http_time)")'?" yes; then date $(date -r "$(http_time)" "+%Y%m%d%H%M.%S") >/dev/null fi fi if [[ -s $HTTP_LIST ]]; then _i=${INSTALL_URL:+install=$INSTALL_URL&} _i=$_i${TZ:+TZ=$TZ&} _i=$_i${INSTALL_METHOD:+method=$INSTALL_METHOD} _i=${_i%&} [[ -n $_i ]] && ftp -Vao - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed /tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; for _f in dhclient.leases.*; do [[ -f $_f ]] && mv $_f /mnt/var/db/. done) hostname >/tmp/myname echo "127.0.0.1\tlocalhost" >/mnt/etc/hosts echo "::1\t\tlocalhost" >>/mnt/etc/hosts if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f; rm /tmp/$_f; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) echo "done." apply if [[ -n $user ]]; then _encr=$(encr_pwd "$userpass") _home=/home/$user uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:$_home:/bin/ksh" echo "$uline" >>/mnt/etc/master.passwd echo "${user}:*:1000:" >>/mnt/etc/group echo ${user} >/mnt/root/.forward _home=/mnt$_home mkdir -p $_home (cd /mnt/etc/skel; cp -pR . $_home) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root >/mnt/var/mail/$user ) chown -R 1000:1000 $_home /mnt/var/mail/$user sed -i -e "s@^wheel:.:0:root\$@wheel:\*:0:root,${user}@" \ /mnt/etc/group 2>/dev/null [[ -n "$userkey" ]] && print -r -- "$userkey" >>$_home/.ssh/authorized_keys fi if [[ -n "$_rootpass" ]]; then _encr=$(encr_pwd "$_rootpass") sed -i -e "s@^root::@root:${_encr}:@" /mnt/etc/master.passwd 2>/dev/null fi pwd_mkdb -p -d /mnt/etc /etc/master.passwd [[ -n "$rootkey" ]] && ( umask 077 mkdir /mnt/root/.ssh print -r -- "$rootkey" >>/mnt/root/.ssh/authorized_keys ) finish_up } do_upgrade(){ get_rootinfo while :; do ask "Root filesystem?" $ROOTDEV resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "$resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/$ROOTDEV)..." fsck -fp /dev/$ROOTDEV >/dev/null 2>&1 || { echo "FAILED."; exit; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED."; exit; } echo "OK." for _f in /mnt/etc/{fstab,hosts,myname}; do [[ -f $_f ]] || { echo "No $_f!"; exit; } cp $_f /tmp/${_f##*/} done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network startcgiinfo munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!"; exit; } mount_fs feed_random install_sets finish_up } AUTO=false MODE= PROGNAME=${0##*/} RESPFILE= while getopts "af:m:" opt; do case $opt in a) AUTO=true;; f) RESPFILE=$OPTARG;; m) MODE=$OPTARG;; *) usage;; esac done shift $((OPTIND-1)) (($# == 0)) || usage if [[ -z $MODE ]]; then case $PROGNAME in autoinstall) AUTO=true;; install|upgrade) MODE=$PROGNAME;; *) exit 1;; esac fi . install.md rm -df /tmp/lock rm -f /tmp/update if ! $AUTO; then ( while :; do lock if [[ -e /tmp/update && "$(dmesg)" != "$(/tmp/update kill -TERM 2>/dev/null $$ || exit 1 fi unlock sleep .5 done ) |& CPPID=$! retrap fi AI_MODE= AI_SERVER= ROOTDISK= ROOTDEV= PACKAGE_PATH= SETDIR="$VNAME/$ARCH" CGI_INFO=/tmp/cgiinfo CGI_TZ= CGI_TIME= CGI_METHOD= INSTALL_URL= INSTALL_METHOD= HTTP_DIR= HTTP_SEC=/tmp/httpsec HTTP_LIST=/tmp/httplist WLANLIST=/tmp/wlanlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -n '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot HTTP_SETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && HTTP_SETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") NIFS=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed /dev/null 2>&1 for _if in $(get_ifs dhcp); do set -- $(v4_info $_if) [[ $1 == UP && -n $2 ]] && continue ifconfig $_if delete down -group dhcp 2>/dev/null done if ! $AUTO; then cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT elif [[ -z $RESPFILE ]]; then if ! get_responsefile; then echo "No response file found; non-interactive mode aborted." exit 1 fi rm -f /ai.done echo "Performing non-interactive $AI_MODE..." /$AI_MODE -af /ai.$AI_MODE.conf 2>&1 ct-c;c $0@9t-cP"&t-cP"&t-cP"&,Y(V(V(V(p9&&,ct-c%P%%%%\%P&xf&|f&<.cD8ffs8ext2fs^8cd9660r8msdos2lockf@`  $f&,f&4f&%&h&&%,' 'l 'T ' ' ''$f&,f&4f& '"'!'e&f&"' ' %'"'' ' 'df& '&''h'!'L(' ' '% ' 'g& ' '<"'' '+''\/',f&4f&/'/'/'0'%%/'%/'%/'/'df&/'.'/'.'p0',0'/'/'%/'/'/'/'/'0'/'/'. .. ''t'f&'''f&''T''E'''q'''''<'T'''|?' 'Ě'g&ؖ'''D'ȑ'D'$''Ԍ''l''' @''Կ''x'9T2c (`2c (t'(2cX'|'^^333396(l6(   ʚ;  ʚ;ʚ;ʚ;@B T T T T T@B@B@KLا O [ @T  6nQ%l7J.c@])Su|@@]Su/ 2!@G"#)$S%|&/'@G(_L )u *v +,u-/.2/_L 0e 1 2I34S5u6@7|8/9`:u;@<@=/>l?l@2A/B`C`D@GE "F "G_L H@I/JlK/LlM2N@GO2P@GQRST`U@GV "W@GX "Y_L Zu [_L \u ]v ^v _ pp@@@@   j  j  j @ _(\;c;c (,(V((((V(h(<9(;c;cd,2>c6* (*'**>cC0**F*<*+(*>clD* *T**\***>c8^*t\*Z*`*>ch*t\*Z*`***>c+t\*Z*`*+>c)+t\*Z*`*>c)t\*Z*`*))`)п)>c8^*t\*Z*`*(^*t9Hc dXL>cP>cX>c\>cT>c<8Q @X,>c>c>c>c4c>c>c>c>c>c>c>c>c>c>c>c>c>c>c!h;c>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy:8Ĝ4844̜44D4ܫ4444|4x4I9\44L444d4$444$4,444????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? Boldface.iso1 c@cwfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0| /t> Y> /> Y? /(? Y@ /@ Y D /PD YD /D Y!Y`>!/d>!Y@!/@!YC!/C!YHH!/H!YJ!/J!Y8K!/DK!YK!/K!YX"/X"Y"/"Y"/"Y"/"Yh"/t"Yd!"/p!"Y`%"/l%"Y&"/&"Y\*"ND^8 /l*"Yp/"/x/"Y/"W//"Y0"/0"Y<3"aP^8 /L3"YP^8tzd3"/d3"Y6"^8p^86"/6"6"p Y8A"^8 /HA"YA"/A"YA"/A"Y B"/,B"YB"/B"YD"/D"YE"c E"/E"YLF"ȧcc@,c0cdF"/dF"YF"/F"YH" c/H"YXJ"/xJ"YL"/L"YL"/L"Y$N"/DN"YLcY^8/N"'/XO"YY"7/Y"YZ"EZ"</Z"Y\"/\"YP]"/T]"Y]"/]"Y,^"/<^"UcDa"/Da"v\a"da"Y`d"cP/dd"Yd"cpd"/d"Y@e"De" /De"Pe"f"4Y g"/g"Yg"c@/g"YXh"$(c7`h"/`h"Yi"Ji",/i"]Hi"Yhi"/i"Yk"qk"x/k"Yk"/l"Yxm"m"/m"n"o"\\o"Yc/p"Yp"/p"/8s"Yv"/v"Yx"/y"Y@y"/Dy"Yz"z"H/z"YЀ"/"Y`"/h"Y"/"Y"Y^8/"Yԇ"/("Y"/"Y"/ "Yԉ"/؉"Y"/"Y"/"Y"/"Y"/"Y"/"Y"/"YP"/T"Yc/X"Y"^80/"YX"Y^8/|"YН"Ydc(/ܝ"Y8"/@"Yt"/"Y "/,"Y"/"Y"/"Y"/"Yc5B/$"Y"P/"Y"/"Y"\/"Y"/"Y "/$"Y"/"Y"h4c/"Y"YcrYHc/"Y"/"Yx"/|"Y"/,"Y"/"YP"/T"Y\"/l"Y"Y_8/"Y"/"Y"/"Y"/,"Y"4c/"YD"8c/T"Y"/<"Y@"/X"Y "/$"Y"/"Y"/ "Y"/"Y"/"Y"/"Y"/"Y"/"Y"/"Y4"/d"Yp"/"Y"/"Y"/"/4"Y"/"Y#/#Y#/#Y\#/`#Y#/#Y`#/d#Y #/ #YL#/T#Y#/#Y#/#Y8#<#|/<#Y,#/8#Y#/#Y #Y#cY`8/0#Y#/#Y0#/@#Y-#Y`8YX$c/-#Y0.#/8.#Y.#//#Y2#/2#Y4#/4#Y5#/$5#Y:#/:#/x;#Y;#(YhC(cccc/C(YD(/D(YhD(/lD(YD(/D(YF(/F(YDH(/LH(YK(@;c8t8 /0K(Y N(/N(Y@Q(/DQ(YT(/T(/U(YV(YD;c$/V(YV(/V(YdW(/W(Y(Y(/,Y(YZ(1/Z(YZ(/Z(Y\[(/`[(Y[(/[(Y\(/\(Y`](/d](Y_(/_(Y`(/`(YVP(t/P(Y(]`w8b(8/(Y(/(Y (/(YP(/`(Y(i/(Y(/(Y<(/D(Yx(/|(Y,(/D(YT(iy8fy8/\(Y(/(Y )/()YX)oy8ly8/`)Y)/)Y)`y8/)Y)cy8/)Y)ty8 /)YX)/\)Y)/)Y,)/0)Y)/0)Y)/)Y)/)Y )/ )Y$)/ $)/8*)Y+)/+)Y-)/,-)Y(<)y8/<)Y =)/@=)Y H)/H)YdH)/hH)YK)/K)YM)/M)YLQ)/PQ)YS)/$S)Y4V)/DV)YV)/W)YW)/W)YxX)y8/|X)/X)YxY)+y8 /|Y)YlZ)/pZ)Y])/])Y`^)9y8/d^)YL_)/_)Yxb)Cy8My8/b)Yc)Wy8/ c)Yc)/c)Ye)/e)Yi)/i)Yl)/l)Yln)/|n)YDq)/Xq)Yps)Yy8a/|s)Yx)/x)Y~)wy8/)Y()y8y8/@)Yp)y8/)/)Yd)/h)Y)/Đ)Y)/)Y)/ )Y`)/h)Y)/)Yl)/t)Y)/)Y$)/,)Y)/)YT)/h)Y)/)Y̞)/ܞ)Y|)/)Y),z8/)Y)/)Y)/)Yd)/h)Y)/)Y|)Yy8/)Y,)/@)/x)Y4)@z8p/<)Y)8P/)Y)/)Y,)/0)YȪ)#8L/Ъ)Y$)/()YDz83/@)YD)/H)Y )/$)YD)/L)Y)/)Y)/)Y()/,)Y)/)Y)/)Y)/)Y)/)Y<)/H)Y)/)Y)> cOX8/P)Y)]L8 Y;ck/п)Yl)/t)Y)r(c/)Y\)/`)Y)$c/)Y0)/8)Y)/)Y()/,)Y)/)Y`)/t)Y)/)Y,)/0)Y)/)Y)/)Y)h8 /$)Y)/)Yp)/t)Y)/)Y,)/4)Y)/)Y)/)Y)/)YH)/P)YD)/H)Y)/)YD)/H)Y)/)Y )/)Y,)/D)Y)/)Y)/)Yt)/x)Y)/)Y)/ )Y)/)Y4c,c /D*Yx*/*Y*t8/*Y*>c/*Y0*/@*Y*/*Y */ *Y */4 *Y*/P*Y<*/h*YH*/X*YT>c/*Yh*8c4cG/t*Y*Rc/9*Y=*/ =*Y=*/=*Y@*/$@*Y4E*/8E*Y4H*/H*YI*/hJ*YN*/N*Y0P*/4P*YS*/S*YZ*/Z*Yp\*/t\*Y$^*/(^*Y4^*/8^*Y`*/`*Y`*/@a*Yxc*Y0@c/c*Yd*/d*Y8f*/Df*YHk*/`k*Ym*/m*Ylo*/to*Yo*/o*Y`p*/pp*Yp*/p*YDr*/Hr*Yr*/r*Yt*/t*Yx*/ y*Yy*/y*Yp}*/}*Y*/*Y*/*YL*/\*Y*/*Y`*/d*Y<*/D*Y*/d*Y(*/D*Y|*/*YP*/l*Y*Y8@c/*Y@*/P*Y*/*YP*/T*Y*/*Y*/ *Y(*/D*Yx*/*Y*/ *Y*/*Y*/*Y*/*Y|*/*Yp*/*YX*/\*Y(*Yl@c/T*Y*/*Y(*/8*Y*/*Y8*/T*Y\*/p*Y*/,*Ȳ8Y@c/d*YD*/P*Y8*/@*Y*/*Y */t*Y*/*Y */8*Y*/*YH*/T*Y(*/p*Y*Y@c!/(*Y4*/H*Y0*/<*Y*/*Y*/*Y*/*YH+/`+Y+/+Y+/+Y+Y4Ac.7/+Y<+/D+Y\+/d+Y+/+Yt+/+Y+A/+Y+Lܕ8Pܙ8Tܝ8Xܡ8\ܥ8(/+Y+aܐ8e܄8i܈8m܌8/+Y\!+/l!+Y(+qܔ8/((+Y܄8u/@(+Yx(+/(+Y1+/2+Y4+{`Ac@/4+Y5+/(5+YE+/E+Y@T+{Ac@/DT+YT+/T+Yd+/d+Yl+/l+YDp+8/Hp+Y{+H8/|+Y+8@/+Y+Ȩ8@/+YH+8 Y8/L+Y+/T+Y+/\+Yx+(8H/+Y(8/+Y+p8p8$p8/p8/+Y+/Ц+Y<+/p+Y+/+Y+:p8Ep8Pp8[p8Yp8f/+Y+pp8Yp8|/+Y+Ac/+Y+p8@88Yp8/ +Y+/+YP+/T+Y+/(+Yl+/t+Y+/+YԻ+/ܻ+Y+/+Yľ+/̾+Y+/+Yl+/t+YD+/L+Y+/+Y+/+Y+/+Y+/+Y+/+Y$+/4+Yt+/+Y +/+Y+/+Y$+/(+Y+/t+Y+YtBc/ +YxBc/x+Y+YEc/+/+Y+8/+/T+ /+/H+Y(+8/0+YEc#/+Y|,.8/,Y,/,19 ,/ ,Y,C8R,`/,Y,/,Y,/,`zH,/H,Y,88,/,,Y,m\e/,y,(/,, Y,,/,<&,,/<&,h(,HYd),/),/+,Y7,/ 7,Y<,/<,Y=,/=,Y?,/?,YtH,/H,YL,/0L,Y`P,/hP,Y$T,/,T,Y|Z,le 8 /Z,Y`,xe /`,Yb, e Y8/c,Ypp,/|p,*/p,Yu,/v,Y0,/8,Y$,6/,,Y,/ ,YȈ,/؈,A/0,Yh,TY8YEca/l,Y,/,Y,/ ,YP,/T,Y0,ne/D,Y,/,Y,/ȑ,Yܕ,/,YH,/X,Y,/,YЙ,/ԙ,Y8,/<,Y,/,Y,/,Y,/,Y,/,Yl,YD8YEcx/,Y,/,Y0,/@,Y,/,YEc/,Y,/,/|,Y,/,Y,/,Y,/,/,/,Y ,/,Y|,/,Y,/,Y,/,Y,/,Y ,/$,/p,Yl,e/p,/,Y,/ ,Y<,/,Yp,/t,Y,/,Y,/,Y,/,Y,/,YH,/L,Y,/,Y,/,Y<,/@,YL,/P,Y$,/,,Y,/,Y@,DGc,Gc/P,Y,,/8,Y,/,Y-/-Y|-/-Y -/$-Y-/-Y$ -/, -YFc/ -t -Y -' -0/ -Y-/ -Y@-48/P-Y8-B-/T-YT-U`-(/`-Yx-/-Y-d/-Y-t/-Y$-/$-Y'-/'-(-Y,-/,-Y.-/.-Y4-/4-/5-Y87-/H7-YT8-/X8-Y 9-/<9-YE-8/E-YHH-/PH-YI-/I-YK-/K-Y,P-/8P-/,V-Y0W-/@W-/0Y-Y_-8_-d/8_-Yt`-/`-Ya-/a-Yc-/c-Y$d-/(d-YHe-Pe-0/Pe-Yxh-/h-Y k-/k-Y,l-/4l-Ym-/m-Yq-/q-Yxs-/s-Y(t-Y8+/8t-Yt-/t-Yv-/v-Yv-/v-Yx-/x-Yhy-/ly-Yz-/z-Y\-/l-Y-/-Y-/-Y8-/@-Y0-Y\Gc:/4-Y -/$-Y0-/4-Y@-/D-YP-/T-Y-/-Yȓ-/Г-Yؔ-/ܔ-Yԙ-/-Y8E/l-YH-/P-Y(-/8-Y-/-Y-/-Y-/-Yȣ-/̣-Y4-/8-Y-/-YH-/X-Y(-/,-Y-/-Y-/-Y-/-Y-Pe/-Y-/-Y-f/-Y-/-Yȸ-/̸-Y-/-Y-/-Y,-q/8-|P-Y(-(8/4-Y-/-Y-/--dY-/-Yh-/-Y-Hc /0-Y-(e/-YD-/H-Y(-Hc,e(HcP-\/P-Y--/-Y-/-YL-YtHc$T-/T-2d-<x-Y\-Fd-/d-Y$-/,-Y\-YHcQ/x-Y-]Te@/-Y-/-YP-/T-Y-/-Y@-/T-Y-/-g/-Y<-/@-Yt-re/|-Y-/-YL-/d-Y-/,-Y-/-Y-/-Y-/-Y@-/L-Y-~/-YT-YHc/d-Y-/-Y8-/<-Y-/(-Y-/-Yp-/|-Y./.Y./.Y./.Y./.Y./.Y./.Y|./.Y./.Y ./ .Yt .eh/ .Y ./ .Y.YHcY<8/.YT./X.YD./H.Y(#./,#.YT'./X'.Y,(./0(.Y*./*.Yx,./,.Y,./,.Y/.//.YT0./X0.Y0.g /0.Y$2.e/H2.Y4./4.Y 9./$9.Y:./:.Y;. g Hc /;.Y=./>.Y?./@.Y A./A.YB./B.Y$M./,M.YTR./XR.Y0Y./8Y.Y\[./d[.Y\./\.Y\./\.Y^./^.Yb./b.Yi./i.YHc /dm.Yn./n.Yn./o.YHq./\q.Yq./r.Yr.D8 YHcYD8/s.Y\v./`v.Ydw./hw.Yy./y.Yz./z.Y,|./0|.Y }./<}.Y\./h.Y./.Y./.Y.)/.6/.Y./.Y./(.Y./.Y,./X.YĞ./.Y,.AIcRgfg/L.Yܢ./.Y./.Y./ .Y|./.Y./.Y./.YT./p.Y./.Yh./t.Y./.Y.x/ .Y|./.Y\./`.Y./.Y./.Y<./@.Yh./l.Y./.Y`./d.YĹ./Թ.YP./T.Y(.YIc/,.Y./.YT./d.Y./.Y./.YD./l.Y./.YX./\.Y<./@.Y./.Y(./L.Y./.Y./.Yp./.Y./.YD//X/Y///Y$//8/Y///Y, //4 /Y // /Y$ //( /Y\ //d /Y // /YX //` /Yp //t /Y///Y///Y//0/Y8//</Yl///Y/Ic//Yh//|/Yh///YT//l/Y///Y///Y#//#/Yh$//p$/Y%/YIc/%/YX'//`'/Y'//'/Y*//*/Y`+//l+/Y3//3/Y4//4/Y5//5/Y<7//H7/Y7//7/YP://h:/Y://:/Y\>/Y Ic/h>/Y?//?/Yp?//t?/Y(C//8C/YE//E//0G/YTJ/ 8/\J/YJ//J/YK//K/YL//L/YN//N/YPP//TP/Y$Q//,Q/YR//R/Y(Z//PZ/Y`//`/Y|e//e/Yli//|i/Y8 /i/Y(l//0l/Yl//l/YDn/LIc%DIc/Ln/Yo//o/Yr//$r/Ys//s/Yt/1/t/Yz/=/z/Yz//z/Y~//~/GYXIcS/h/Y/[//Y,//0/YP//\/Yl/c g/x/Y//Ȉ/Y/o/Г/Y//̔/YЖ//ܖ/Y//Ș/Y/wLc$g //Yt///Y\/LcLc/t/Y/$g//Y/Lc/8/Y̮///Y/8//Y,//D/Yd//x/Y///Y///Y4//0@8 /L>0YxA0/A0Y\C0/`C0YpC0/xC0YC0/D0YD0/D0Y%T 9>%/ 1Y 1/ 1%P 1(Y| 1% 1D/ 1%10Y1%1/1%1LY1/1Y"1% 9x/("1Y$#1&(#1/(#1Y(1 &(1T/(1Y,1&-1/-1Y.1/.1Y01/01Y@31/`31Y 9)&/31Y31/31Y31YH 91&/31<&D&31/31Yx41/41Y41O&`Nc]&tNck&Ncz&51l/51Yl61&t61L/t61Y71&71/71Y$>1/@>1Y,?1&H?1/H?1Y8D1&|9t&9t&d9x&9x&dD1h/dD1YJ1&J1/J1YdK1/lK1Y(N1&p 9&3Ysc$6/D>3Y?3/?3Y?316g/?3Y@3/@3YA3/A3Y`B3/dB3YG3=6sc /H3YH3/H3YI3/8I3YK3/K3YL3/L3YM3/(M3YPN3M6/hN3Y`O3/dO3YO3/O3YP3/P3YR3/R3YS3/S3YT3/T3YU3/U3Y V3/XV3YY3/Y3Y\3/\3Y`3/`3Y@a3/Pa3Y|c3/c3Yr3/r3Y0s3Z6g/4s3Yt3/ u3Y,u3/Xu3Y8v3/Dv3Yv3/v3Yxw3/w3Y0x3Y8sck6Y`x36tc6tc/x36z36`y3Yy3/z3Y@{3Ytc/D{36{36{36|3 7|3 7{367 |3Y|3P7/|3Yt3/x3Y43/83Y43/83Y\3/`3Y@3/D3Y3/43Y|3/3YT3/X3Y؋3/3Y 3/$3YducY7/Ȍ3Y3f719\/3Y3/3Y3/\3YH3/3Y3/$3Y̭3Y19t7/ԭ3Y37X294YucY\297 wcd7pwc\7wcd70xc\8xcd)8xc\G8Lycd`8yc\~8/3Y3/3Yس3/3Y3/3YP3/`3YH3Y zcY398/3Y3/3Y38 3/ 3Y3/(3Yl38p3t/p3Y zc8/|3Y$3/03YT3/h3YD3/T3Y3/3YP3/3Y38?9tYzcY?98/3Y3/3Y03/43Yp3/|3Y 3/43Y3/3Y,3/@3Yzc8/3Y$3/,3Y3/3YL3/X3Y3/(3Y 3Y<{c8/L3Yt3/x3Y39{c/3Y39{c/3Y<3$9{c/H3Y309{c/3YT3/X3Y3/3Y\3/d3Y 3/$3Y43/<3Y3Y{cY`D9;9{cI9/3YD3/H3Y3/3Y3V9ga90|c /3Y3/3Yh3/p3Y3Y E9Y{cj9E9 z9E9|9/3Y 3/3Y3/3Y3/3Y(3/,3YL3/P3Y3/3Y3/3Y3/ 3Y83/@3Y3/3Y3/3Yd39 g9d|c/3Y3/3Y3/3Y$3Y<|c9/<3Y\3/d3Yd3/h3Y43/<3Y3/3Y3/3Yh3Yh|c9/t3Y3/3Y3/3Y|c9/3Y3/3Y3/3Y84/@4YT4/\4Y4/4Y4/4Y4/4Y 4Y|c9/4Yp4/t4Y84/@4Yd4/l4Y4/4Y 4/ 4Y 4/ 4YD 4/T 4Y4/4Y(4/,4Y4Y|cY G99/4Y49g/4Y\4/h4Y4/4YP4/T4YX4/l4Y4/ 4Y4Y|cY|G99/4Y4/4Y4/4Y4/4Y !4/ !4Y "49\}c:`}c:d}c/<"4YD#4/T#4Y#4/#4Y &4/@&4Y&4/&4Y'4/'4Y )4/$)4YP)4/X)4Y)4/)4Y+4/+4Yx,4/,4Y-4/-4Y/4//4Yd/4/h/4Y04/04Y44Y4}c :/`44Y<4/<4Yl=4/=4Y B4/PB4Y(E4/DE4YE4/E4YdF4*:/pF4YG40:}c ?:h}c /4G4YJ4Yh}cN:/,J4YdJ4/lJ4YK4Y}cY:/0K4Y|L4/L4Y8M4d:/|_9>`9$>`9n4>"a9,D>Na9[>^a9$k>a9>a9>(b9 >2b9F>xb9>c9>c9d>6e9?f9?g9/?g9??g9O?6Y>6/>6YA6/A6Y0C6YcY\z9UA/B/t6Y6GB\9 /(6YD6/H6YP6/T6Y86/H6Y6/6Yh6/l6Y6/6Y6/@6Y6/6Y6/p6Y6/6Yd7/l7Y7/7YT7/|7Y7Y|cYH9QB/7Y7/7Y$7/,7Yx7/7Y7/7YH7/P7Y7/7Y7/7YP 7/X 7Y 7/ 7Y\ 7/` 7Y 7/0 7Y 7/ 7Y 7/ 7YL 7/X 7Y 7/ 7Yp7/7Y7/7Y7/7Y7/7Y7/7Y7/7Yh7/t7Y7/7Y7/7Y7/7Y7/7Y7]Bh9/7Yx7/7Y87/P7Y7/7Y7/7Y 7/87Yh7/7Y7/7Y 7/ 7Y"7kB9/H"7Y#7/#7Y@&7/t&7Y(7/P(7Y(7YcYT9yB/(7Y(7/(7Y)7/(+7Yp+7/t+7Y,7/-7Y/7//7Y/7/07YP07/p07Y<17/L17Y27/ 27Y27/27Yd37/h37Y37/37Y\47/h47Y47/47Y57/57Yx57/57Y67/67YL77/P77Y77/77Y77/77Y87/87Y87/87Yt97/|97Y97/97Y;7/;7Y;7B9@/;7Y<7/<7YL?7BЃ98B98Bx98B98B(98B`98B98B@98/?7Y@7/@7Y,A7/8A7YA7/A7Y B7/B7YB7/C7Y\H7/H7YI7/J7YJ7/K7YM7/M7Y$N7/,N7YhN7/|N7YO7/O7YP7/P7YQ7/Q7Y U7C9D/LU7YW7/W7YhX7/tX7Y[7/ \7Yx\7C9dYԣcY9%C/|\7Y]7/]7Y_7,C`g /_7Yb74Cc>CcJCc/ c7Y$d7/(d7Yld7/td7Ye7TCL9YcYL9_C/f7Yf7kChgtCjg/f7Y v7/v7YLv7}Cd9,Cfg/Xv7Yv7/v7Yy7Yd9C/y7Yxz7/z7Yz7/z7YD{7/H{7Y$|7/(|7YD~7C9 /X~7Y\7/7YcC/X7Y07/47YHcC/l7Yl7/t7YT7/X7Y,7C/<7Y`7/t7YL7/\7Y`7/l7Y7Y9C/7C/l7Y$7/47Y؟7C 9/ܟ7Y7Y\cY9C/7Y7/7Yl7CD90/p7Y7YcY89D/$7Y̦7/ 7YD7/T7Y7 D9/ĩ7Yl7YcYt9D/x7Y7/7Yd7D9</h7Y7YԤcY9 D/7Y7/7Y7(D9$/7Y7YcY9/D/7YD7/T7Y7/D7Y@7/D7Yh77D9/l7Yd7Y$cY9>D/p7Y|7/7Y47/@7Y7YLcY 9FD/7Y7/$7Y7/7Y(7ND$90/47Y7YtcY9UD/7Y7/7Y7^Dl9$/7Y7YcYT9fD/,7Yh7/x7Y7oD9/7Y7YĥcY9wD/7Y 7/7Y7D90/7Y47YcY9D/@7Y|7/7Y7D90/7Y7YcY9D/7Y7/7Yh7D89/l7Y7YclG$cwG1G5Gb#G(G/%8G\!8G7\GcI`!I@4I6Il'@J"\Jm5%JpM48>Jo(LJHC%$VJ8X,hfJ+sJ,j#~Jpm)JT J GjJ52LJ 'J|i/hJD(TJ&JD0J2cK0viK,)K0K$5(Kh,9K<"CK2|OKCc$aK!zK&!,Kx pK  4K0I/,Kl[)pK< 30K(J6K̐4<Ky"D L0)LL+)LJ!(@L4SLw1iLx (~L&(L:0La3L L6PLh/L@#4LܦcL4c-M'7M&&EM&UM h^M)4hM^2`zM?6,MhMР&pM 5M2cMhMI$XM\;M%0Mp4M8c NW2LNx# 'N 0N0$4NL6pCN 'pON)$ZN1kNX/X}N"tN ;N+Nv2Nh;cN0#N|"`N3!TNX.lO$-O )\6O(~c?O78PO`7bO^&L}O08Ov1OhO)@Oe0O$OgOh( O+LO1hOK) P PX2  POc?Ph $PPD+0_P "8hPW4`yP9 PHc$P@-P,)cP5PjP=jP*XP1Qh1Q[1%Q/6p4QЪ)XTQ`g5DjQX7yQ3(Qv3Q 3 Q4+PQ@*Q!hQ 4Q.&8QG%4QGj Q%8RP7RtH0`(R<'4Rph>R$TKRLPc RRw#[R"h@kR, Rt)7RԹ.R 0RgR|.<R|#TR4R+cRh9S`^0S 'SH%8%S0l1SU%XXb#KXHs"WXe/hXthxX<. X .X`5$Xl40X& X/cX@)X&pX 'XT"X() Y#@.Y@ 8YbhDYcNY48\Y ,jYH9`{YTJ.Ya5@Y45dY3Y#.,Y$tY3\Y{9NYG"Yx3Z0Z8/ZhBcBZX\6VZ\jaZ%nZ+pZM%<Zx4(Zĸ0dZ'PZ1Z(48Zh4lZ$c4Zs-ZH%-HZi(Z#[d(3 [P@c2[+>[0",J[i4`[gl[0PF\H#W\l'pc\ 3p\3\<"'l\6t\p@j\)\45\10\>c\+]']T5']h2],2%t=]@#8M]% []p6c]68r]P5]$5$]>c](H]t&7]6]A%0]4N5])l]8`]4<^ #(^0)4^8G^|8HX^3Tt^e$`^^#^P0^.^(5^5$^'\^'^"l^/^*c_#_|^2L_h+_86_D1XQ_i__ )k_ '@v_!_|{!_|c_Gj_{1_'(_B"_7_t5X_|I)|`cT%`6/`4;`cD`"8P`04``ct6Gc3H]c_2ncrcc>cc>ccL1c.cgc|=)c(c(c2dD\)xd-d,.d*L:d&XDd +4Qd' ^d'md$ydH2d7xdp6d$.dt44dX.jx d4 d.ddgd,7e8 $heĄ(4*e&H6e*(Ee`5Uel{i0^egjeX6\te;c~e18le1et@je$e$e|#em#e42e-@f6f4@ f!.2fHEc(Nf( h[f+Tkf77yf 4fZ)$fؾ(fpU8f5f!fXA"<g8;TCcg`$#gc,gc k40kdO3tk6h(kdw5Pl% Gl"xWlx!flhK&vlX#lgl'l6@l(<l4#ll7/l\ 8l\hl8Q!pl\%c m "mg.my1@m, Im!XmL1im'zmD1tm(mw5Pmcm0Z&xmOcm$m mly-dm|.(nD5n7(n||c=nKcLn"LUnDK!Xanԣcind|6`snQ9nP1nP n8@n7`n"n)n.ny*oX !,opj4@0o|hsh !hMsO4tas8-xpsf5ds|3,sP?j s(LcsT+sIcs5s/ s@.,tD$t$ct"8-t( EtHp+ Ut"btH#<lt1$}t0octd.pt6uu8-u `u@ju,u+Tu<{4u|ocL|0+\|1!@m|d |$.4|H&L|Pj| -|hW |7|,2`|5|&4}#}x+@ }?)8?}L-M}J/[};&dc};#xq} (\}N3,}z1}t)D}T'}.c}7\}\K)d}V(0~nc~D5~tz1/~|!A~hh%8 J~|0PP~,q9 ]~(3&he~m1||~4 ~xh~/4~ 7x~U6~Hc~ u-~ $T~p&(~^6~45 Fc@,%%2$!E,@OP'cb5ht 8p07 t56p 9Y&l52@$8(\'T * 't i6h:$'0L5df2H|9P~+L[h4, s`5hP%`! GjTe5 30րhj5bh!hc;' ; 4l%[6:4-L|+4Tk#`1X|  ;jN(,D#`",)cӁt?/`&0|.$T- 3A"&g;%( E63@Y$`b;l8D926@)p΂0 ,T, `(0$0pocs/4+l%3(3\A4(QH3`f (,?(\h'`' '<"<t58ȃL4$Ճ>c$S$t&( !0H1&P% 1x)p9p(HCT%MH+]'4k!9x%tx3p!\OjƄ@.̸-0D&l{1@.,E-, 0 :.'D@jV,9 b m@[8u 1.p0+ h#(4ԅH64݅6l4G4td(@.@?/`,8)<4 L +6Uz1hhrh(&L< \ 6Q$<ņ'<І+܆%-&k7`$, 5H",c).EZ8JJ#J@6[(p',``5* H19xx 8HĊTq2Ί'Hފħ @tBc{6xg5@!XM(+&pb$qć,{Bc$'P 43cH%Ȑ8%͐)!O38#l47x `j -@! :t1HB.`Z&i&ttt&d~'#\@%`5\7 <(4ԑ!hޑ,T4~c >c0X552,`&(,840? $OK#X\tp2tl!(4{a6y$@#ij&N40`*ʒ"(8ْ$.0,##+'08$c0R8+)8"4CLD5S\?j^2fkgn$0p~3#X\7и#HL58s6/(ȓY-ؓh)Hd*" h78&g2piA,8 L,dU|qc`6th1/$Hy%$H'T$t\K#|)Ɣt88ؔ, l%6l$h2$(2x1B`}3PR|1@iV0DvT!D6,H!p xǕv6ԕ$Gj&a$`g!-2<5-TM %[gh/v$c! h%L&Ě'<8\p*c̖$6Ԗ 72Lޖx0'D$0T((pN 3_@#Dj "8sPB44x@j\5 3ϣ$cߣB'~10Y#X"@4; F*t'$5<\s4tI\,PT"`c0&r7~p]4h&( 44_8,2Ǥ#٤ L*pԑ5$p%441*@(GjKxl1d`U#,r.2| E9 4.,(@ )`x;#(ȥb#ԥ3<.8 $54@&|c:L>cG)(\'Ljf%tKch.,8t96t8J3LϦP%0ݦH$t@3|@jd4xU4(-)7G.HW'Sx4xct /p2x4U!8(§`5|ڧ4l.,H%$D$ c#,.d"\ET4]|Q4r =*hh4"@ Lc$(6h0ĨЖ2\֨(%Hި|'h7+th#"B$P/L5\C,$dOX/DY$ta#sp(NcL'DT"@, b# ̩T"ש<8 "`(5 4DE4D'M0\8H%=pgJl6T&`.ox'@g@6Ĉ1,2T5LǪ$2Ѫ&ߪL=jM'cl7H`'\(%XB$('D4Ԙ)8G$3S Lcg+)zP(7lܝ"dg8ccI%XL:7ЫP)$(1 D)c."0)++<gF{cSt(tgY4XCc(t(|gDv3DŬ,u1Tͬ-׬"X#<d2`$p`8X ؟%T*#:h8XG|%<YM$ h\+${ #; ,+8hP=jͭ"\ۭLc0(c2D.de%$~c8l 30BHy9KgW&a&w<#`Dc+`$(^8خ 1,o/L$s# x!,8X5/G')4ZX|'mt$P|T=j"( xI% \6LNj- ͯ#֯4$,(cdg<6x1.X0(h>c#Jhg7Da.Lu /55 \/ʰD-ذFc߰p74D+ T9%'@ q1B2!P8@47LB9-SH7/c#@rH6Xz0,S$d7p'<{iñ$cұ#!45,Gj }( l}!)338%)R ;Xpc^l.@k*<x<cc-cr(lg 5P$% (cgȹ4ݹ<8D-'(Z&g1H'<2c7H%T>5 V. l(itpbh~'D,3,60 :j;cźD>3Dٺ\/cg8(J.<a|h7x24M/?(L<cx4@2 $&/<!8X3t$3<+  5lc)(=dhG-Zpd!xmĞ%Hw@j\.X<=$|8'd5ܟ&-#"%T S!@)Pxi8 >P~cV-9h)$-h'@&|3+Thu446d$t"Љ X&X8"8`|3д4&<'40"@=U'N,0lXdj`p}2DnXc$0x43 }+; \00g$pH5~580 5d4Z0,Z-+p#!DA<5Tv-0b-cot> @}@jd[.@7% $L\c7$5@P.t*@+%tt+ P--K$8v5tP83fH1sA.L#, D.d .l'L68Ģ%D!$,0d)3($l1@X-#H0<4'DD%0M"8D]6p`3HjP"T"4ԵgF)t(,(3%8#p;7 lw4X1d+h"@<0u7O'H]t%6loD(2|gx @3 Ș2 5<TP6D40\$- $<3.$3:&3,O8@c^)c lh7X~)v( . T % f(8Oj Ic$8.c\5x'D  Nj$\g/5DZ2pY(cbc-ht-c} +h)\ R#|lg77,xT"z0hk' gN'N1\,10D<|"I@(-Xy0oxh`xs"hg,g1ll#%,@4Ty0|3,(# v1/3(1p-8(tA؈,XN7^Ԍ'o`#w!$~)l$c$' ;zlj T9T6H0$xP$>c#!5M!A1Yȑ,Ld(c o&hx,H̾+)S3 8$g10jp"ĉ3 `8#+t'54%xC83YPCc$lD%voc~\5 3Xj2\,$&,X.8$4@/\(hb5$PjԹ00&t)3̲&<أ%D0U-`0b-n0'H{Xg#4-+<^"< ;̲4@d%xԆ2(D$U#5L64&4 0}c,(%(c 3 $)\I cQT,(\<&g'Pn8Gj w.&@Z%4@1,,K3Hc,h &h0t+ &\hqc l7%83 2F-lW0<[D`'TfH5(r\Y4PD/\4h %t8D; ;0m'A"  (' %$1Dj=}/Jt'[hg5tm400.Tck 0Pwt-H&7L %`!X5'LscԪ-%pЦ+$ P* ܟ7D1,p4B.8PWv4pc,-8q(`sc(8*̖ 58,0&h'$'@@Z!x,'Գ("D5-4$AT#<K%VX8c($zPA"g6.l 3(x3lc( )c$,_$0:x6hH|Q9`S02c _('j&Hq4( 2D 2,@ch) "@@c̬% xz#c#"X02/0 ('T$l"9<8$hJ-,Z`(k%uК 8d7(ȴ6 \7\.1P'8"k(@,4' 6\Hc%8G'4&4= !V* f܊9 sd5t.@z H\;c+ `+<6|D/c^%t$#(0&X ,hE$Lg)&"86)cCd2Q+_)v,0'D`8 dq73<(,Lg P6P%Pj`ucL'D# |+6T$#x15ALNc])g 0~03$),&(Pscx827@5,'<5&O!\#q4l4P&8?7OXV3Padjy(,^(\.dXT LiD@c()`)`h58%,:'H$R4&^D2mpL Xx4x5Th.d)&6P\'L@&0|o5g4t}2 x0l '&` 76,C&)Zcad<%|kA5yk/| Kc+dc$Xq3x*])<v7H ;j-6t7l3<T.ex o6y *$4*("?,t4($5#, 844`~i&(.6x'i/3T2<L&<Y$4g@gn,3D~+d`2pzi`s8`24 Gc*cZ$8pNj$p$l5 3\.7tiF`,\P,5^9 j9 v8( 0>c,c$7|hgKc5&dc5T{3+A(7H&0AH.\N,5Dgp 5~N/z.04-p(\,)%+d{1 'I)d U#((- l%$/5t<$6FziR38]'xo1T|%&(P3|s)D(` 4 D(D" %<-x%6<1EMcT$bgot/d%ctgq9DPcQ+0'X(9 %04" .. 02D,`!)&+(* 6p&8A (Zdz1m88 vS56)cL'&l$c8q9 P3|,N56l<#3 ca$.cq $ }t#`6~/D`v.c8g 7L6X#!X3LXNcg!0'"<-4l4*B"SX6]3qH"~pg0c5$c.2tch*c|2D3cQ&<b<,0wOc|6\@1g5lU.X%`\#L31+$4@7S4$LH24`8"Pg %r'"x-,ذ2i)$ 3Թ#\#,+ pK%$6' 5?c $140p%;4m7 D4\Ԉ1/.LDHcM/'<X5HaM5kh ~P8T(58L&\\2cx $Ī& $ @jD*H'P#){5P6'<Cx2K-0Y39` d0w-0'4L ,D T)pg4`pBcHl&x)c  p@c0h"8(C%$Rظ%cl!q-cI!0d24'%S'h6xpF4P&X T!`65X,01#\"<L#@FgSd "8c`t5`yT%c 0h(%0\5,#t%(xF)Pd1  0g0G/,`k*L:='G#tUDM!HbY4{?'O5P,4ll+xc :2(,Q/h?j)d=j % "$" )c0 ,N7: a4HI 7,V @F$Ta 'j x&y [$L   d6  G9H Lpc #   7( x5L!u$!% !,c,!T8d*$&$3$)$"$0;$7`$hH)$Tc %8'%g)%g6%+@%X1V%X4l%xE9 x%!x%$%1%K7%b6%`Y1%(%' %%%Nj &С%&e2!&8,4&&4A&078T&(k& Z t&&L&$&XY-&w1&J#p&F"& 3&X)44&hh&l#'c'\*'|Q8('43L6'@jM'$_'gu'"'\&<'8c,q6T',S4;,/O,0\,08c,h4u,T&8,\j,(,',8s",L3,@j, 8,+ - ;- ;!-/.-D.<C- yiS-(o-%dy-01<-(/8-&(-8M)D-+-g#L-M7p-@&4-x=j@-&@-tj7@.A7T!.d#0/.E$(:.,3P.$9.e.Gcu.4h}.x X.t6./#.D 0.p 9.P1.#8./2/h-/`{ h)/XNj9/ hA/&4 H/-4S/9[/$/1dh/-8~/X+/0V%/@!/{9/,00/c/["/<~c/7/Pc/P300(%P0'<+0\3;0@NjM003W0# f0m8n0('Dw0 ,0=,0,H/p0lh0k$0\n#H0640"0 c0t5`1Q514,/1H&61,!H1 " Z1|{c0k1!{1n71I51(.1B31d*X1S(1! 1z/17 25423H)2 ;$82;=2,cM2a2Ha2m2xn21v2"P2Q!l2,2@32#d2!+\2 |2c2c4+ 5.c5tX$!5: .5h 34D58P5!,_5@js5(M3@5 @c5pg`5u65+65675T,c5L t50(580d5 68 6506#p<67M6400Y68,d64Xo6"z64X64't6!'@6إc6 46Ec$6D;c6%64746 8`7+74%$7 '7@;07$T87e&@I74`Q7i2]79 j7+v7#7 `7|6*,7$7$\7LV87@+87$c7P77y58y-!8/18,J4A8!3R8,&j8!8W08(c(8% 8@j8i18ħc8 8t8Hr*8p58ȸ191$96*@"9Tg'8)9 49t+7@9g"T9p,He9#Xr9ؠ29)X9?79 3H9 a29h9lT!9xe'9l'D9*$:Li7<:g(:@6p> ' >3.>8,87>-#LE>X$3P>,-$Y>hf>,o>$8P~>h!>4 34>S2>1>->y7>64>t(d><,%>h78?@ .\0?',=?8J?'dZ?}cl?H)u?2d?V1?GL)dPG$-cG@i&rG\#!G[1LG'HGh&\G<8 G6\G|(2GT+,G< GNjH/'H+"Hy#)H&4H) AHs(LHx@c\H@!2lH{-4yH,HP;c H&H,#H6lH.H#H(S4<H@jHh:/$HT0I#TIz1"IHV.4I6?I2QIH;jZILu$fI|,<sI@$Ih%IP$8I81I+DIP*I!pI6 I2<Ity5|I|6 Jgd JԊ6Jn1)J8, 4Jz9;J~iIJ0!VJ6bJ.LvJ,!`JXx5tJ\(JH%8J (J3J(-J,TJl&K18K%K3K20K7=K8KK4\"ZK7lK5K$/$K 3lK@cK6`K/4K;7K&4K0$\KKcK#  Ll1!L/,L&|=L 7GL@jXL.XnL6tyL,.DL3$LP"4Lxf#`L0@2,LXD$LcN6<NȘ/8!N !1NT&=N]8UN@%8teN\&,oN"@zN5N/(dN$ND6Ndw2Nl@cN!(PNd /|N1LNi7T Oy1O6%O#! 2OP5DO)QOr84`O"gO5dwOܘ2OL%O/O3Ox$.O(y9OPjOgO! P 2,P(|,P 54pBP8s/OPd?jVP( /<fPcV[)hWh !H+Wp5?Wܖ/hVW'cWR3xWm*W(06W@/cW@4lWD,HWP5`WDi2W/W0~5XQ4 Xpx%$Xph#0X p@X /lNX_& [X>6 gX"oX+XL.X$X6Xz1Xl 8XD5|X8#Xl*" Y((+Y5X&Y4>Y|$)RY6 ]Y4DwY@PcY@%Y\8Y8U9@YA28Yd>!YH6`YT$Y.8Y$Z&Zu5X(Z\Gc4Z =Z3\NZl7[ZD#eZT6`mZ&yZ5Z 'Z'Zh`Z$00Z0&Z5TZ(XZ2!Z*h[8[l7[`0 "[8C/T1[h8[c?[.\[ #4n[ 9 z[H'|[ ,[!H[8pc[ [t5[/$[i[($[t9 \/(\d#x!\,-L,\1$4\\6xF\$5P\h=j`\a(l\"Tz\G4\ 7p\*\h\,3,\\%(\@=)<\4f&\$3]i]4@2]i4hB]p%M]4;]]`D9m]Cc$]<10],,]7]$S)]@j]1]T0 ]`!]/(^U$x^h#^W6 /^`5\;^H 9(D^$yiO^ c^T3s^l.^+\^05\^8$|^\Ac^%^ D.8^,d^Ԅ5T_-._ )X*_%43_^(L@_lhP_th\_68l_3z_&l_P,_# _&4_31_h6_@7 _؍3(_m_6Hm5Sm3%lam/#im8t-4um\1dm14m8f5`m 6lm(5tmcm4u!`m"m"  n%nxJ"h%nD 5`4n@jHnOcanginx,crnj$|nHr4Tnx6 n3n*8n$C&,nO)Hn0Lṇ-ln>colZ4Po<2#oXg(7o4(Eop3No(5Xo` xio|Y)|oTNjo06ode4o(oH#oco`1oT2@p*0p+Xp(5ph2Hp6.|^pГ- np<*yp7(@pn7 p`[((p84pX0.p4-$phuip0'PpL'pX% qX%0q1#q u5X6q44Uq`-^q# <hq07tqDNjq"4qgq\"q|+!pq q'q"0q$q-`qv3hr"r0' r p+r`10,:r,/,Brb1LPrXh\rL, pzr (r .xrA2,r\,$rT*r7r2r7rw gFwZcMw̘!Xw1lw\ zwt)@wT|.`wh7dw@4wn.w|3w0@w"w1(w&whxY3x !hxF6@+x|c3x$7>x83Wx`.exЏ#8sx"xP x(9x$)<x54xM)xF68x2xH yE)+y5|;y3Ly|2@Yy0*ayTk2|ry(Pcy,.y2cy)yz7 y@jy&zgz5z+0'z$03z\+H?z/6Tz1fz.l{zW2\zDu4$zH1Dz?,z !,zl ;z7z 5Hzb(z|6tz34{i2<{84{=)S{g]{ k{/D u{@J&({${c{,7T{ȹ!{w1{x;c{'P{0g{& |t)8|'T&|) /|l6(HB|54S| 3c q|)cx|,Q! |8`| %||Dq9|Gc|3|-H|($`|g}$$$}A5}x#&} /}0J4<=}@X!C}/XT}9 `}K5v}(}[5t} T)8} 6X} o4}P3}hh} 75~X10~i*~>( 5~0w1E~08V~8%_~XE5`l~P4~f&@~!~{1p~86~t%d~p"|~3~` 3l~%~%LDh& 9"t@c*>c34) >"(O [87\l(8wg~X 7f5 .@T!\'s.X0Y-(}c0R#H`!d""x02>c>J% ID(]T9e4o`)<{(0iE)u(~.ˀpt8zc,B" .h"H+z92H/cB]4Vh$c_"l'~H9"@&L,#L#Ɂd4ف6("|6@(..h'`>c9g%B+4`L4a@3rll7pEc4.cԛ%8\7$Oc/@Ƃ-&ւNjh,3$g T27 \@c2(.x@3hO]6X4,cЅ7DlT7Ty)d1&(d-(g2 ;ŃP7L؃68#8R4P40T.(*c/PN$T=4zcK`']7j!|$70س2g0c 0d@cƄ&̄)cڄ|:8!5(m6\@%<21OcId'Pp; X02i2yT.%!2j)(+Lƅp*Ӆ%ۅ*/ )}2H1)$4$B<7Q\3bxgk }<5ܻ+v1LjtCc$҆%چl.!L210t$ &D,4&7f#=0@BV8lTX3e\3(v(,(X"0(!,ÇMcЇ0'0 ݇z1y7@Lj(B2 & "h#&p- /<XgOu4H^OjqL@ccp=j5!pH%8#ƈxt1׈"|1)cn6 l.-t$c :7(F`/!tZ;b$7(nlE9 y@j:*8u4Nj0 Ή6HF0L+68zi(P%T 0,@.;4A2@E$3(Rhm1(fe14t0Dc(q9y1&(\\m&8H&Ɋd%ӊ Hc#t(  H;c<{$#hO ,oc2f4|L(U4pfx(3r0/8z8&3 h2\3΋1`ߋ$cts"HD58 Q$$ĩ7+t 65H(4P%`Zh%cdt68p0*0 zoc~iD>(Ph2Hi5 ,̌"<֌;^ٌ7 '', |"H{1.;E8X\d>c i!h$rcAncI4}cOZ4`\ t6 e0!w6p,'h7&|\#Tc1ŘTHj՘1Ic L.P th4-5!Cp+Ql8 _1ll(c&P$XL45̄8hęH9˙2'| 2c *8 ا)'!=g7DQ.bPho 00)(@" 8 \74Қ 34%;$| B$8}#lPa3H'd.lBB(J#^<.lr !d7(<x/"P(7x) xɛcR+lt2@$1LR'!O53@jF&S87ThLU%LsDQ(}$tL$!h0hG6d%Μ@#lٜ`38"M4Y#dP)P0U2$$ /'P.t#8$4Dܺ$<U$3b1 wT@cLh30` D.'(ĝP-ם(+ U43"@($ )34#:P#C"@OL#4^d5g$3x4:%02.(, &Lo50ўg7 (^*%|"(}5Aj%\%h0T#7@5A-HMl+`;cr($yAj 4 0x+:#$x8 %*6\ҟtc<+ě66P sc#Hc ,#c2P%3Dt L2Tt+d ,$u18| 6t*dd9 ++̠I%ڠ ;0Nc &f7 83$3AjDDNcNLc_:.dkEcz)<gH1Ȕ0 6<ơ41xϡT+\ݡ;k7`|3T t+h)(Z82s!`P,H\*4fcft PvG9(&2c H782Ĥ)cҤe#&!pG9  3'}2`' h4"A|c N-g`Y-|w$6w00/8T&ʥtU.ۥ)x6T9l~c"%%t2 30E K'W5\di.lp/h&|(%P3\("1)Ʀ1զdf&<{c,p8ȯ$\/'L)<)PBziJ@Jj]hnNc@~%$r"6HNcC6l$4ѧd&74G6Lf$ 4 %,$, /X$(=$ "pEt5[(|ck.*v%T~P"&g0\/"&̜4ɨ+بp0 8Oc$3X~7&P%&#c 02c?D"OL,\s5nԙ,hzȖ EcD&&g<3(é ҩA.T) )"  8< 2`)W1 2#;LH%$C@5X$)44`>cs-DP)c #l|(t2tǪc*\Ѫ|7ߪ=*"\8 72 50$8g/J; :!2<L.'V2fB!s6\x"(P$L4 Db(7(/Ы!(( h&lA$`c hf'X#0$HT2H67PC*`P`t8jȦcsT2$1*%/3,'lˬx&ج"%03icHA"8Ұc۰l6\|73tl70 .&$DJj .91)c@(gGOcZ(kX3@}X]3g'!0Ʊdw08Ա-/c$3&x(g!$TZ6L/2`;#`I,.fte$<rg},1p1N*+\($TȨ g8J3P~F(D'0c6$d'ɺW7@ۺ4(X@'@ 'l.(M5T0Ȫ C8P-OC%Xu4\fw6q!.Xg`x$=$04m8,KjXcȻP]7,ػ /2cd!!ȿ-ؿxclgpk78)H'D%'T/'l;,ocCxI9U3f 5s93p+ l, 0-Ocy H'D-8)t4|3/7H%8@5@b#@8T>c`&Ti06hsDD.*`3$4 e6\T( 2'8|7LXW7`6 5@ x&d2(PJj 1pO$J6U2Ha/drL)T&# )8dN5hxC%,@c\q.ܳ5d`i Aj%H@c8 ;B\<0M)L^;csb2`6p94pb#x5!8`287-d`+h'DX,c8*X2@51O4X1Y$|pph{p4xe)$r/ui c[4z1c(, Kc*8b5ED3V]"Pb5<u>cL+$ hcTr5(D q' '@#<@c8& H7-#&)c3l -pE$pcN }3T_8scf_2wOchTqc-d50L%1+D%  g'$Pl!+4*T COc\S!i+4\q4@{ȝ- 'w4$h2\h_28O7L5 .d lD(lx5T$,f&7h(D@.Sȫc `,)v(8F'0c3D(! 8(D̯#tt5 p*hp@Ac'd.@2%,<%J;VlS64ad400"L )X/c#\)|c}c-{/0'Dg&H8'D1 $08`8G35lU&0a=*dq_!\|60,`N)h%0{1W0,1O)d${'@Aj"{15j1tHPhR$*(ah0Lp^)4oc(0"Y#XLjui "PN9++x D*(&l(%ll(6_$@>d4Q8Nc]\(t6H@*8^*tp9 h 6P<4\c5\@>1*t78ء6-$T?t'5 Qx&*ZX#Ley&p T7pOc/-cN#p7o0px 1N$8,`;(lc7$tF.\3gH"PI#\$!\gD$r`N8L7<2pT%|g%(8(0 ,"l720U#0 h(|c&Lj9+ G%@R 1d`1p$$x1950h('Lc%l0K4P)X<'AjI9( 0l/6X"E| l\7(g6q8Ej1e#_#TLNj', /' $$.nc../../../../arch/zaurus/zaurus/zaurus_start.S$azaurus_start_ramLcopy_sizeLstart_off$dmmu_init_table2Lstartup_pagetablemmu_init_tableLstart../../../../arch/arm/arm/locore.Ssvcstkparam.cioconf.clocvers.cmii_bitbang.cwdc.cinited.7596if_wi.cC.27.6945if_wi_hostap.cne2000.ctest_pattern.4943dl10019.cax88190.ccom.ctiocm_xxx2mcrcomcons.8196lsrmap.7937ohci.csoftraid.csoftraid_concat.csoftraid_crypto.csoftraid_raid0.csoftraid_raid1.csoftraid_raid5.csoftraid_raid6.crd.ccf.7115hfsc.cbio.ccons.crefcount.6712diskmap.cfirmload.cdp8390.cdp8390_test_memC.5.5203rtl80x9.crtl80x9_media.4942rnd.cchacha_keysetuptausigmachacha_ivsetupchacha_encrypt_bytestwist_table.10262extract_pool.10323_rs_seedrs_bufrsrs_havers_count_rs_stirrs_initializedcd9660_bmap.ccd9660_lookup.ccd9660_node.ccd9660_chars2uicd9660_rrip.ccd9660_rrip_reldircd9660_rrip_stopcd9660_rrip_looprrip_table_getsymnamerrip_table_analyzecd9660_rrip_defnamecd9660_rrip_deftstampcd9660_rrip_tstampcd9660_rrip_defattrrrip_table_extrefrrip_table_getnamecd9660_rrip_extrefcd9660_rrip_idflagcd9660_rrip_altnamecd9660_rrip_slinkcd9660_rrip_contcd9660_rrip_devicecd9660_rrip_pclinkcd9660_rrip_attrcd9660_util.ccd9660_vfsops.ciso_mountfscd9660_vnops.cclock_subr.cmonth_daysexec_conf.cexec_elf32.cexec_elf64.cexec_script.cexec_subr.cinit_main.cinitpathsinit_sysent.ckern_bufq.ckern_clock.cpsdivpscntkern_descrip.ckern_event.cfilt_timer_timeout_addkern_exec.ckern_exit.ckern_fork.cidx.14124lastpid.14110lasttfm.13933lasttfm.13934kern_kthread.ckern_lock.ckern_malloc.cBUCKETINDXkmem_map_storekern_rwlock.crw_opskern_physio.ckern_proc.corphanpgkern_prot.ckern_resource.cinitialized.11843kern_pledge.cpledgereqpledgenameskern_sched.ccpuset_allnum.4881kern_sensors.ckern_sig.csigwaitsleep.13865kern_subr.ckern_sysctl.ckern_synch.cunlocked.10470globalsleepaddrkern_tc.cnow.3459timehandstc_ticktimecounterstimestepwarningsboottimebincount.3713dummy_timecounterth0th1th2th3th4th5th6th7th8th9kern_time.cnanowait.11375kern_timeout.ckern_uuid.ckern_task.ckern_srp.ckern_xxx.csched_bsd.cschedcpu_to.4897subr_autoconf.cmapplysubr_disk.cduid_str.9293init.8326uuid_unused.8332uuid_openbsd.8327uuid_msdos.8328uuid_chromefs.8329uuid_linux.8330uuid_hfs.8331uuid_efi_system.8333gpt_uuid_openbsd.8334gpt_uuid_msdos.8335gpt_uuid_chromerootfs.8336gpt_uuid_linux.8337gpt_uuid_hfs.8338gpt_uuid_unused.8339gpt_uuid_efi_system.8340gpt_uuid_openbsd.8356subr_evcount.cevcount_listnextid.3322subr_extent.cextent_alloc_region_descriptorextent_free_region_descriptor__func__.3337extent_insert_and_optimizeinited.3104subr_log.cdropped_count.12209orig_error.12210subr_pool.cC.52.5771C.50.5722C.51.5744__func__.5293__func__.5093__func__.5476__func__.5128dma_alloc.cdmanamessubr_prf.cpanicbuf.7382subr_prof.csubr_userconf.csubr_xxx.csys_generic.cflag.12399sys_pipe.camountpipekvapipeopssys_socket.ctty.cprocess_sumttyechottyrubottnreadtty_conf.ctty_subr.ccctty_tty.cuipc_domain.cpffast_timeout.3766pfslow_timeout.3767uipc_mbuf.cnum_extfree_fnsmextfree_fnsmclnamesuipc_mbuf2.cuipc_proto.cuipc_socket.cuipc_socket2.csblowmem.4171uipc_syscalls.cdns_portcheckuipc_usrreq.cfptounpvfs_bio.cvfs_biomem.cvfs_cache.cnamecache_comparevfs_default.cvfs_init.cvfsconflistvfs_lockf.clockstr.4713vfs_lookup.cvfs_subr.crb_buf_comparexxxfs_mntid.16016toggle.16051vfs_sync.csyncer_workitem_pendingnext.5055incr.5054start.5053vfs_syscalls.cchange_dirvfs_vops.cvfs_vnops.cvfs_getcwd.cspec_vnops.cdead_vnops.cmsdosfs_conv.cdos2unixu2lunix2dosmsdosfs_denode.cmsdosfs_hashremmsdosfs_hashinsmsdosfs_fat.cfatblockmsdosfs_lookup.cmsdosfs_vfsops.cmsdosfs_vnops.cfileidhashbpf.cbpf_sysctl_lk.9742bpf_filter.cbpf_mem_opsif.cif_idxmapifq.cC.9.4573C.7.4507C.5.4488C.6.4489if_ethersubr.cetherbuf.6098digitscrctab.6162crctab.6181rev.6180unit.6114if_loop.cif_media.cradix.cmax_keylenrn_zerosrn_onesaddmask_keylast_zeroed.3439normal_charsraw_cb.craw_usrreq.crtable.croute.crt_init_donert_timer_timeout.6677__func__.6395rt_hashjitterrtsock.cieee80211.cbasic.6620ieeerates.6812rates.6786mopts.6409chanflags.6653ieee80211_amrr.cieee80211_crypto.cieee80211_crypto_bip.cieee80211_crypto_ccmp.cieee80211_ccmp_phase1ieee80211_crypto_tkip.cPhase1SboxPhase2ieee80211_crypto_wep.cieee80211_input.cC.21.7171C.22.7178C.19.7150C.20.7157C.28.7581C.24.7360C.12.6966ieee80211_ioctl.cempty_macaddr.5948ieee80211_node.czero.6622ieee80211_output.cup_to_ac.6569C.16.6817C.18.6840C.19.6841C.22.6894ieee80211_pae_input.cC.14.6276C.10.6019C.11.6026C.8.5869ieee80211_pae_output.cieee80211_proto.c__func__.6606ieee80211_rssadapt.cieee80211_regdomain.cieee80211_r_ctryieee80211_r_namesieee80211_r_mapif_ether.carptimer_to.4967__func__.4971__func__.5158igmp.crouter_alertrti_head__func__.4829in.cin_pcb.cin_proto.cinet_ntop.cinet_ntop4ip_icmp.cicmperrpps_counticmperrppslim_lastmtu_tableicmp_redirect_timeout_qip_id.cipid_initialized.2761ip_shuffleisindexip_input.cipsend_mqipsend_taskip_send_dispatchC.3.7504C.4.7505defbaddynamicports_tcp.7482defbaddynamicports_udp.7483ip_output.craw_ip.ctcp_debug.ctcp_input.ctcp_output.ctcp_subr.ctcp_timer.ctcp_usrreq.cudp_usrreq.cip_gre.cip_ipip.crijndael.cTe0Te1Te2Te3rconTd3Td0Td1Td2Td4md5.cPADDINGrmd160.csha1.csha2.cK256K512sha384_initial_hash_valuesha512_initial_hash_valuesha256_initial_hash_valueblf.cinitstate.3047cast.ccast_sbox2cast_sbox1cast_sbox3cast_sbox4cast_sbox6cast_sbox5cast_sbox7cast_sbox8ecb_enc.cdes_SPtransset_key.cweak_keysshifts2des_skbodd_parityecb3_enc.ccrypto.ccriov.ccryptosoft.cxform.cxform_ipcomp.carc4.cmichael.cpad.2819cmac.chmac.cgmac.cC.5.3076key_wrap.cIVidgen.cidgen32_gidgen32_ftableidgen32_rekeychachapoly.czeroes.3639poly1305.cU8TO32U32TO8poly1305_blockssiphash.cSipHash_RoundsSipHash_CRoundsffs_alloc.cfsnoinodes_last.5402fserr_intervalfsfull_last.5321fsfull_last.5272ffs_balloc.cffs_inode.cffs_subr.cffs_softdep_stub.cffs_tables.cffs_vfsops.cdone.9204ffs_vnops.cufs_bmap.cufs_ihash.cufs_inode.cufs_lookup.cufs_quota_stub.cufs_vfsops.cdone.4777ufs_vnops.comastertemplatemastertemplateext2fs_alloc.cext2fs_hashallocext2fs_fserr__func__.5483ext2fs_nodealloccgext2fs_alloccgext2fs_balloc.cext2fs_bmap.cext2fs_bswap.cext2fs_extents.cext2fs_inode.cext2fs_indirtruncext2fs_lookup.c__func__.5659ext2fs_readwrite.cext2fs_subr.cext2fs_vfsops.ce2fs_sbchecke2fs_sbfillext2fs_vnops.cuvm_addr.cuvm_amap.camap_small_pool_namesuvm_anon.cuvm_aobj.cuao_find_swhash_elt__func__.4899uao_flushuao_list_lockuao_initialized.5254kobj_alloced.5213kernel_object_store.5212uao_listuao_getuao_pagein_pageuvm_device.cudv_referenceudv_flushudv_faultudv_detachuvm_fault.cuvmadviceuvm_glue.ctoggle.5627uvm_init.cuvm_io.cuvm_km.ckernel_map_storeuvm_map.cuvm_kmapent_mtxkernel_map_entry.6980uvm_kmapent_last_warn_timeuvm_kmapent_warn_rateuvm_meter.ccexpuvm_mmap.cuvm_object.cuvm_page.cinitialized.6788virtual_space_startvirtual_space_enduvm_pager.cuvm_pdaemon.cuvm_pmemrange.cuvm_stat.cuvm_swap.ccount.15994uvm_unix.cuvm_user.cuvm_vnode.cip_ecn.cin6_pcb.cin6.cC.21.6616in6_ifattach.callzero.5313allone.5314in6_cksum.cin6_src.cin6_proto.cdest6.cfrag6.cip6q_lockedicmp6.cicmp6errpps_counticmp6errppslim_lasticmp6_mtudisc_hiwaticmp6_mtudisc_lowatbuf.8010icmp6_redirect_timeout_q__func__.7967ip6_id.crandomtab_20ip6_input.cip6send_mqip6send_taskip6_send_dispatchip6_forward.cip6_output.croute6.cmld6.cmld6_sendpktip6_optsmld_timers_are_runningmld_all_nodes_linklocalmld_all_routers_linklocalhbh_buf.4777nd6.c__func__.6554nd6_init_done.6313__func__.6314__func__.7128__func__.6749nd6_nbr.cdadqdad_init__func__.6220__func__.5870nd6_rtr.craw_ip6.cudp6_output.cgetsn.crandom.cexplicit_bzero.ctimingsafe_bcmp.cstrchr.cstrrchr.c__main.cimax.cimin.clmax.clmin.cmax.cmin.culmax.culmin.cmemchr.cmemcmp.cbcmp.c../../../../lib/libkern/arch/arm/bzero.S../../../../lib/libkern/arch/arm/bcopy.S../../../../lib/libkern/arch/arm/memcpy.SLmemcpy_backwardsLmemcpy_fl4Lmemcpy_fdestulLmemcpy_fsrculLmemcpy_ft8Lmemcpy_fl12Lmemcpy_fl32Lmemcpy_floop32Lmemcpy_floop12Lmemcpy_fsrcul3Lmemcpy_fsrcul2Lmemcpy_fsrcul1loop4Lmemcpy_fsrcul1loop16Lmemcpy_fsrcul1l4Lmemcpy_fsrcul2loop4Lmemcpy_fsrcul2loop16Lmemcpy_fsrcul2l4Lmemcpy_fsrcul3loop4Lmemcpy_fsrcul3loop16Lmemcpy_fsrcul3l4Lmemcpy_bl4Lmemcpy_bdestulLmemcpy_bsrculLmemcpy_bt8Lmemcpy_bl12Lmemcpy_bl32Lmemcpy_bloop32Lmemcpy_bsrcul1Lmemcpy_bsrcul2Lmemcpy_bsrcul3loop4Lmemcpy_bsrcul3loop16Lmemcpy_bsrcul3l4Lmemcpy_bsrcul2loop4Lmemcpy_bsrcul2loop16Lmemcpy_bsrcul2l4Lmemcpy_bsrcul1loop4Lmemcpy_bsrcul1loop32Lmemcpy_bsrcul1l4../../../../lib/libkern/arch/arm/memmove.Sffs.ct.1531fls.cflsl.c../../../../lib/libkern/arch/arm/memset.SLmemset_lessthanfourLmemset_addralignedLmemset_lessthan32Lmemset_loop16Lmemset_loop4strcmp.cstrlcat.cstrlcpy.cstrlen.cstrncmp.cstrncpy.cstrnlen.cscanc.cskpc.c../../../../lib/libkern/arch/arm/htonl.S../../../../lib/libkern/arch/arm/htons.Sstrncasecmp.cadler32.ccrc32.ccrc_tablegf2_matrix_timesgf2_matrix_squareinfback.corder.3172lenfix.3150distfix.3151inffast.cinflate.csyncsearchupdatewindoworder.3244lenfix.3192distfix.3193inftrees.cdbase.3078dext.3079lbase.3076lext.3077deflate.cputShortMSBlongest_matchlongest_match_fastflush_pendingfill_windowconfiguration_tabledeflate_slowdeflate_fastdeflate_storedzutil.czopenbsd.ctrees.cinit_blockstatic_l_descstatic_d_descstatic_bl_descpqdownheapscan_treesend_treecompress_blockextra_lbitsbase_lengthextra_dbitsbase_distbuild_treebi_flushstatic_ltreebi_windupbl_orderstatic_dtreeextra_blbitscompress.c../../../../arch/arm/arm/in_cksum_arm.Smainbus.cfdt.ctreetree_initedcpu_mainbus.ccpu_mainbus_attachcpu_mainbus_match../../../../arch/arm/arm/bus_space_asm_generic.S../../../../arch/arm/arm/bus_space_notimpl.Sbs_notimpl_messagebs_notimpl_panicLbs_notimpl_bs_mmap_textLbs_notimpl_bs_r_1_textLbs_notimpl_bs_r_2_textLbs_notimpl_bs_r_4_textLbs_notimpl_bs_r_8_textLbs_notimpl_bs_w_1_textLbs_notimpl_bs_w_2_textLbs_notimpl_bs_w_4_textLbs_notimpl_bs_w_8_textLbs_notimpl_bs_rm_1_textLbs_notimpl_bs_rm_2_textLbs_notimpl_bs_rm_4_textLbs_notimpl_bs_rm_8_textLbs_notimpl_bs_wm_1_textLbs_notimpl_bs_wm_2_textLbs_notimpl_bs_wm_4_textLbs_notimpl_bs_wm_8_textLbs_notimpl_bs_rr_1_textLbs_notimpl_bs_rr_2_textLbs_notimpl_bs_rr_4_textLbs_notimpl_bs_rr_8_textLbs_notimpl_bs_wr_1_textLbs_notimpl_bs_wr_2_textLbs_notimpl_bs_wr_4_textLbs_notimpl_bs_wr_8_textLbs_notimpl_bs_sm_1_textLbs_notimpl_bs_sm_2_textLbs_notimpl_bs_sm_4_textLbs_notimpl_bs_sm_8_textLbs_notimpl_bs_sr_1_textLbs_notimpl_bs_sr_2_textLbs_notimpl_bs_sr_4_textLbs_notimpl_bs_sr_8_textLbs_notimpl_bs_c_1_textLbs_notimpl_bs_c_2_textLbs_notimpl_bs_c_4_textLbs_notimpl_bs_c_8_textarm_machdep.cast.c../../../../arch/arm/arm/bcopyinout.S../../../../arch/arm/arm/copystr.Scpufunc.carm_dcache_l2_assocarm_dcache_l2_linesizearm_dcache_l2_nsets../../../../arch/arm/arm/cpufunc_asm.S../../../../arch/arm/arm/cpufunc_asm_armv4.S../../../../arch/arm/arm/cpufunc_asm_xscale.Sprocess_machdep.csig_machdep.c../../../../arch/arm/arm/sigcode.Sesigfillsyscall.cundefined.cgdb_uhgdb_trapper../../../../arch/arm/arm/vectors.Sarm32_machdep.cbootsyncdone.9103bus_dma.c_bus_dmamap_sync_segment__func__.8831cpu.cwtnamespxa2x0_steppingspxa27x_steppingsgeneric_steppings../../../../arch/arm/arm/cpuswitch.S../../../../arch/arm/arm/exception.SLreset_panicmsgLprefetch_abort_handler_addressexception_exitabortprefetchabortprefetchmsgLdata_abort_handler_addressabortdataabortdatamsgLaddress_exception_msgLundefined_handler_indirectionLundefined_handler_indirection_datafault.cdab_fataldata_abortsdab_buserrdab_alignmem.cphyslock.7737pmap.cl1_lru_listpmap_pv_poollast_bootstrap_pagefree_bootstrap_pagesl1_listpmap_l2ptp_poolpmap_l2dtable_poolstatic_l1.7357csrcpcdstppmap_kernel_l2ptp_kvapmap_kernel_l2dtable_kvapmap_pmap_poolstatic_l2.7358pmap_vac_flagspmap_kernel_l2ptp_phys../../../../arch/arm/arm/setstack.Sstubs.csys_machdep.cvm_machdep.c../../../../arch/arm/arm/bcopy_page.S../../../../lib/libkern/arch/arm/divsi3.SL_udivideL_divideL_overflowL_divide_l0L_divide_l1L_old_codeL_divide_b1L_divide_b2L_divide_b3L_divide_b4L_divide_b5L_divide_b6L_divide_b7L_divide_b8L_divide_b9L_divide_b10L_divide_b11L_divide_b12L_divide_b13L_divide_b14L_divide_b15L_divide_b16L_divide_b17L_divide_b18L_divide_b19L_divide_b20L_divide_b21L_divide_b22L_divide_b23L_divide_b24L_divide_b25L_divide_b26L_divide_b27L_divide_b28L_divide_b29L_divide_b30L_divide_b31L_divide_b32L_divide_b0L_udivide_l1adddi3.canddi3.cashldi3.cashrdi3.ccmpdi2.cdivdi3.ciordi3.clshldi3.clshrdi3.cmoddi3.cmuldi3.c__lmulqnegdi2.cnotdi2.cqdivrem.cshlzero.1474subdi3.cucmpdi2.cudivdi3.cumoddi3.cxordi3.cconf.czaurus_machdep.cconsinit_called.8822bootstrap_bs_mapsection_freescsi_base.crqsbuf.5006sense_keysadescC.31.4769C.6.4259C.7.4356scsi_init_done.4065scsi_ioctl.cscsiconf.ccd.csd.csddoingadumpsoftintr.cpxa2x0.c../../../../arch/arm/arm/irq_dispatch.Spxa2x0_space.cpxa2x0_dma.cpxa2x0_intr.cpxaintc_attachedhandlerextirq_levelirqstr.7195pxa2x0_mutex.cpxa2x0_gpio.cpxagpio_softcpxagpio_regsirqstr.5784pxa2x0_clock.cpxaost_scpxaost_timecounterpxa2x0_com.cpxa2x0_a4x_space.c../../../../arch/arm/xscale/pxa2x0_a4x_io.Spxa27x_udc.cpxa2x0_ohci.cpxa2x0_lcd.cstatus.7754basic_color_mappxa2x0_apm.capm_evindex.7503../../../../arch/arm/xscale/pxa2x0_apm_asm.Ssleepdatasleepdata_svcpxa2x0_cpu_resume_virtcache_flush_loopdisable_fastbusenable_fastbusfrequency_change_91frequency_change_208frequency_change_highfrequency_change_on_cachepcmcia.cpcmcia_cis.cinit_cfe.3772pcmcia_cis_quirks.cpcmcia_cis_quirkspcmcia_3cxem556_func1pcmcia_3cxem556_func1_cfe0pcmcia_megahertz_xjem1144_func1pcmcia_megahertz_xjem1144_func1_cfe0pcmcia_sierra_a555_func1pcmcia_sierra_a555_func1_cfe0pcmcia_sveclancard_func0pcmcia_sveclancard_func0_cfe0if_ne_pcmcia.cwdc_pcmcia.cwdc_pcmcia_attachwdc_pcmcia_matchif_wi_pcmcia.cwi_pcmcia_productspxa2x0_pcic.cpxa2x0_mmc.czaurus_lcd.clcdbrightnesscurvallcdislitcurval.6496lcdisblanklcd_scr_descrzaurus_kbd.czkbdondownzkbdontvzkbd_keydesctabzkbd_keydesc_uszaurus_scoop.cdk.5971state.5972scoop_pcic.cscoop_mmc.czaurus_ssp.czaurus_apm.czts.ctail.6569wd.cwddoingadumpwddumprecalibratedwddumpmultiata_wdc.cata.cerrstr0_3.3727errstr4_5.3728autoconf.cdisksubr.cwsdisplay.cwsevent.cwskbd.cwskbd_console_inittedwskbd_console_devicewskbd_console_datanum.8438pos.8439wskbdutil.clatin1_to_uppercompose_tab_inordercompose_tabwsmouse.cwsmux.cwsemulconf.cwsemul_confwsemul_subr.cwsemul_vt100.cwsemul_vt100_subr.cwsemul_vt100_chars.cnrctablenrcovlposdecspcgr2unidectech2uniwsemul_vt100_keys.cvt100_fkeysvt100_pfkeysvt100_numpadrasops.crasops_masks.cflipped.1382rasops4.crasops8.crasops15.cwsfont.cagain.3145builtin_fontswsfont_find0cookiegen.3194bold8x16_iso1_datahid.chid_get_bytehidkbd.cusb.cusb_run_abort_tasksusb_run_tasksusb_nbusesusbdi.cerrinterval.4603usbdi_util.cusb_mem.cusb_subr.cusbd_trim_spacesusb_delay_wchan.4398buffer.4187usb_quirks.cuhub.cuhidev.cuhid.cukbdmap.cukbd_keydesc_usukbd_keydesc_deukbd_keydesc_de_nodeadukbd_keydesc_frukbd_keydesc_fr_appleukbd_keydesc_fr_dvorak_bepoukbd_keydesc_dkukbd_keydesc_dk_nodeadukbd_keydesc_itukbd_keydesc_ukukbd_keydesc_jpukbd_keydesc_svukbd_keydesc_sv_nodeadukbd_keydesc_noukbd_keydesc_no_nodeadukbd_keydesc_us_dvorakukbd_keydesc_swapctrlcapsukbd_keydesc_iopenerukbd_keydesc_esukbd_keydesc_beukbd_keydesc_ruukbd_keydesc_uaukbd_keydesc_sgukbd_keydesc_sg_nodeadukbd_keydesc_sfukbd_keydesc_ptukbd_keydesc_pt_appleukbd_keydesc_ltukbd_keydesc_laukbd_keydesc_brukbd_keydesc_trukbd_keydesc_tr_nodeadukbd_keydesc_plukbd_keydesc_huukbd_keydesc_siukbd_keydesc_cfukbd_keydesc_cf_nodeadukbd_keydesc_lvukbd_keydesc_nlukbd_keydesc_nl_nodeadukbd_keydesc_isukbd_keydesc_is_nodeadukbd.capple_fn_trans.4123apple_iso_trans.4138apple_fn_trans.4113apple_iso_trans.4132umass.cdCBWtag.7282umass_quirks.cumass_scsi.cif_aue.cC.13.5633if_axe.caxe_get_phynoC.18.6201C.3.5890if_axen.cC.12.6165C.3.5888if_smsc.cC.20.6290smsc_devsC.9.5894if_cue.cC.11.5172if_kue.cC.8.5207if_cdce.cC.13.5273cdce_crc32_tabif_udav.cC.16.5641udav_devsif_upl.cC.7.5000if_ugl.cC.6.5002if_url.cC.23.5618__func__.5845__func__.5821url_devsif_ure.cC.11.6519if_wi_usb.c__func__.8355__func__.8062if_ral.cural_def_bbpural_rf2525_hi_r2ural_rf2525_r2ural_rf2526_hi_r2ural_rf2526_r2ural_rf2522_r2ural_rf2523_r2ural_rf2524_r2ural_rf2525e_r2ural_def_macural_devsusbf.cdq.4989zero.5099status.5103zero.5108usbrev_strusbf_subr.csd0.4483sd1.4484usbf_error_strsbuffer.4306if_cdcef.cC.6.5070zaurus_udc.cmii.cmii_physubr.cukphy_subr.cnsphy.cnsphysnsphyter.cnsphyterphysqsphy.cqsphysinphy.cinphysiophy.ciophyseephy.ceephysexphy.crlphy.crlphyslxtphy.clxtphysmtdphy.cmtdphysicsphy.cicsphyssqphy.csqphystqphy.ctqphysukphy.cbmtphy.cbmtphysamphy.camphysacphy.cacphysnsgphy.cnsgphysurlphy.c__func__.4101__func__.4058__func__.4032rgephy.crgephyssdmmc.csdmmc_cis.csdmmc_io.csdmmc_mem.csdmmc_scsi.cswapbsd.cswap_onwi_set_nwkeypfslowtimonanouptimebuf_rb_bufs_RB_REMOVErandomreadaxe_ticklongjmpwi_usb_rx_list_initproc_freefd_getfile_modesr_crypto_discipline_initvfs_allocate_syncvnodetc_setclockpcmcia_printarpresolvechange_displayparamchrtoblktblcd9660read_filtopssw_reg_strategysys_minheritieee80211_tree_RB_NFINDputcharural_update_promiscuvmfault_unlockmapschild_returnsmsc_cartlabel_unrefHMAC_SHA1_Updatene2000_write_mbufsmsc_startuvm_map_initne_pcmcia_caipsec_soft_first_usenkmempagescopyinstraue_miibus_readregsys_getgidieee80211_tkip_micdofilewritevsdmmc_intr_establishwi_inquire_usbdumpmagieee80211_derive_ptkttyflushsys_setsockoptsrp_v_gc_startsys_ppollcomdefaultrateieee80211_watchdogclock_gettimedefrouter_lookupinetswwi_get_fid_usbcdce_rxeofuuid_enc_beip_reassrt_maskedcopyin6addr_anyVOP_ACCESSusbd_get_quirkswsmouse_init_scalingip6_get_prevhdrscheduler_startpxa2x0_gpio_intr_stringpmap_alias_bitsuvm_maxkaddrnsphy_cdsdmmc_mem_sd_switchumass_io_puticsphy_resetieee80211_getmgmtrlphyattachpxa2x0_gpio_intr_establishipmforwardingohci_waitintrzssp_read_max1111ure_init_fifofilt_msdosfswritesys_closeusbd_do_request_flagswsemuldisplaydevsubmatchrtflushclone1sys_pipe2ffs_inode_allocdes_encrypt2sys_setsidieee80211_encapax88190_init_cardzaurusmod__ashldi3vn_statin6_hasmultirn_initmaskunp_detachnd6_nud_hintether_ip6multicast_mintcp_secretrti_find__mainaue_stopufs_quota_deletehardclocksd_vpd_thinenc_xform_aes_ctrsr_raid5_discipline_initsr_rebuild_threadwi_read_data_iowdc_reset_channelin6_domifdetachieee80211_get_authmtx_enter_trysmsc_sethwcsumwskbd_cndetachcd9660_vgetieee80211_inputcrypto_dispatchsr_discipline_shutdownwsmouse_touch_syncgeneric_armv4_bs_wm_2if_group_routechangesys_fstatatnd6_timer_workpxa2x0_apm_sleepohci_device_intr_closeurl_csr_read_2dest6_inputgsignalacphy_caipport_firstautomii_mediachgwi_txeofaue_devsipsendredirectsbpf_setifbuf_flip_highunp_internalizetk_rawcc__wdstartscsi_xs_sync_doneaxen_initfc_lfcemptyvfs_export_lookuprasops_eraserows_rotatedifnetif_cloners_countyieldohci_endpdm_freemwsmuxattachuhid_seltrue_filtopssc_print_addrfilt_seltruecomspeedlogsmsc_tick_taskvn_writechkin_ifscrubarmv4_tlb_flushIuvm_pmr_freepageqdp8390_media_initpdevnames_sizemichael_updatescsi_mode_select_bigroute_dstsingle_thread_clearinit_execsr_schedule_wuuvm_pmr_size_RB_NEXTuvm_addr_alignieee80211_send_4way_msg4wskbd_cdsdmmc_mem_enablezaurus_udc_attachnamecache_rb_cache_RB_FINDbcmpgeneric_bs_r_1ieee80211_node_detachnd6_dad_startgpt_chk_hdrexec_maxhdrszieee80211_ifattachSHA512Initmmmmapieee80211_clean_nodessetjmpsd_read_cap_16prefetch_abort_handler_addresswdc_disable_intraes_ctr_reinitbio_infowsdisplay_switchurlphy_funcsuvm_deviceopsuvm_addr_align_backlogread_filtopsrasops_cursorvndxfer_poolcpu_info_primarytcp6_mtudisc_callbackcopyoutstrfdt_node_propertymainbus_matchaxen_tick_taskieee80211_countrycode2regdomainusb_transfer_completelxtphy_servicepxammc_matchapm_suspendscoop0_set_card_powerswcr_newsessiontcp_attachla_hold_totalwskbd_cngetcbuf_dirtysoo_writesystempagem_zeroural_alloc_tx_listnd6_llinfo_timervn_fsizechkunp_gcingreaddoslabelbdevswcalctsrubaddynamicportsohci_root_ctrl_closeural_ack_rateuvm_mk_pclusterbswap16domainnameuvm_pmr_addr_RB_REMOVEpledge_flockwsmouse_detachttywrite_filtopswi_usb_devsnd6_ns_outputbpfkqfiltersorwakeupinflateCopyttyunblocksr_meta_opt_loadbiocloseremovedeudav_miibus_statchgigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2filt_procdetachsys___thrwakeup__divdi3wsemul_getnameallowpowerdownsys_clock_settimeural_txeofwdc_floating_buspxa2x0_spllowerlocnameshidkbd_bell_fndisk_busyhidkbd_belltcp_pulloutofbandsqphy_statussddetachifq_barrier_taskzapm_power_infoarprequesttfork_child_returnsiginitaxen_casr_wu_enqueue_ccbpool_set_constraintsusb_task_thread_procip_sysctluhidev_closemsdosfs_vptofhscsi_mode_sense_bigusbd_clear_endpoint_stallsetdisklabelbio_registerdeflateknote_removescoop_pcic_writepmap_bootstrap_pv_page_allocbufq_nscan_createsr_hotspare_rebuilduvm_mapent_addr_insertext4_ext_in_cacheroutedomainusbf_interface_numberhid_locateicmp6_errornd6_rs_attachVOP_MKDIRrtl80x9_media_initip_protoxsys_settimeofdaypcmcia_read_cissdstrategyaddloguvm_page_physgetif_input_task_lockedusbf_add_taskmsdosfs_synccheckdisklabelscoop_pcic_attachscsi_mode_senseure_ocp_reg_readip_savecontrolstackgap_randomvm_map_unlock_lnffs_clrblockusbd_set_hub_featureif_congesteduvm_addr_linsearchbpf_filterchgproccntip_drainieee80211_tree_RB_PREVumass_init_shuttlesoqremque__adddi3uvm_map_inheritusbf_rem_taskapmopensys_getthridcd9660_syncin6_ifawithscopebuf_page_offsetuvm_pmemrange_addr_cmpkm_freeusbd_is_dyingzts_pollsync_printvnopsieee80211_rssadapt_inputsys_lchownmsdosfs_removecd9660_readieee80211_regdomain_compare_rnfilt_timerdetachwi_get_idzeroin_addrbmtphy_cdwskbdkqfilterwdc_set_drivecyrillic_to_koi8uvm_map_protectusbd_get_xfer_statuswsfont_enumpxammc_clock_stopuvm_map_setup_mdprintfpxa2x0_splraisecdce_devsrandomwritepxa2x0_cpu_suspendprelist_updatehmac_ipad_buffercrypto_drivers_numsmsc_miibus_readregip6_protoxsys_recvfromswcr_freesessionttrstrtwskbd_mux_openrandomif_getkcopysdmmc_mem_mmc_initzts_sync_sendwsdisplayopenext2fs_initext4_ext_put_cachertfreesingle_thread_checkpxaudc_freemtcp_syn_hash_sizecuio_getptrcd9660_linkwsdisplay_emul_detachhostnamelenupl_cdusb_needs_reattachdeflateTuneusbd_get_hub_ss_descriptorzkbd_cnpollcuaddr_hint_selectxscale_cache_purgeID_rngttyopenraw_ctlinputwi_usb_ctl_unlockzkbd_devpxa2x0_gpio_iohfdt_initbpf_insn_dtornd6_ioctlsched_chooseprocbpf_mem_ldwzssp_ic_stoplcd_set_brightness_internalspec_setattraxe_miibus_statchgpte_l1_s_protoarpinputusbd_get_stringfill_prlistipsec_exp_allocationsHMAC_SHA256_Finalbpfcloseusbd_probe_and_attachdirtyqueuesys_writevsys_setprioritym_tag_prependaxe_cmdurl_unlock_miiumass_detachusbd_free_iface_dataip_defttlif_inputwi_usb_attachurl_rx_list_initdopipeusb_schedsoftintrarpintrsdmmc_activatewsemul_vt100_output_scs94_percentkqueue_registerin_delmultisdmmc_io_rw_directsdmmc_io_write_2pxa2x0_init_interrupt_masksdisk_lookupuid_findnd6_rtrequestuvm_km_suballocusb_delay_msrasops_eraserowsif_getgroupattribsbpfdetachsys_closefromip6id_pmodttydefcharssigexitscsi_link_openhidirtypagesin6mask128bus_space_read_raw_multi_4uvm_amap_poolin_pcballocVOP_LOOKUPsr_raid5_regeneratesr_meta_readapm_pxaip_caphysical_startbs_notimpl_bs_c_8ifa_delenqueue_randomnessexphyattachusbd_set_idleieee80211_find_node_for_beaconemul_nativeaxe_txeofwskbd_inputacphy_cdsdmmc_printwsmux_attach_sccpu_do_powersaveaue_rx_list_initwsdisplay_kbdholdscreenuvm_km_pagesufs_quota_alloc_inode2ieee80211_name2countrycodemicrouptimesr_validate_ioaes_xts_decryptsocket_poolsr_raid_recreate_wupgrphashsys_setpgidpledge_sysctlprofhzAES_GMAC_Updatesr_meta_init_completeohci_setaddrntp_update_secondcache_enterexec_elf32_makecmdsusb_rem_wait_taskext2fs_bufatoffsys_setlogininitarmamap_listpxa2x0_lcd_suspendconfig_process_deferred_mountrootip6_maxifprefixestcp_do_rfc3390ieee80211_req2nodesys_setresuidpxa2x0_lcd_load_fontrn_deletesd_get_parmsiskmemdevstat_rush_requestswi_watchdogipsec_def_compfc_lmdistancepxa2x0_intr_stringure_ifmedia_updnch_poolphtree_RB_REMOVEsomaxconnsdmmc_card_intrural_readugl_initpxapcic_socket_enablescsi_xs_get_donepxaudc_ctrl_methodsipsec_exp_timeoutip_directedbcast_bus_dmamap_loaduvm_pmr_pg_to_memtypeuihashtblieee80211_node_getrssitaskq_syssd_buf_doneieee80211_get_rtsamap_initffs_flushfilesicmp_sysctlsys_lseekdes3_decryptmsdosfs_pollmsdosfs_accessaddupc_intrdvd_read_bcaamphy_serviceure_stopvm_map_lock_read_lnwsevent_finiip6statwsmux_set_layoutuvm_pageboot_allocconfig_pendingmii_phy_updatesys___thrsleeproute_cleargatewaysys_accept4ether_crc32_leaue_csr_write_1ipipstatsecurelevelurl_matcharpt_keepsdmmc_mem_mmc_switchsavectxpte_l2_l_cache_mode_ptpool_multi_allocbinuptimedogetrusagesys_seteuidpxa2x0_bs_allocuao_shrink_hashugl_rx_list_initwskbdpolluvm_map_checkprotauth_hash_chacha20_poly1305max_protohdrdes_is_weak_keyural_rf_writezapm_poweroffieee80211_add_qos_capabilityieee80211_cipher_keylensdmmc_alloc_ccbsumass_scsi_attachsr_raid1_discipline_initrandomkqfilterbufpagessleep_setup_signalrlphy_cdpool_countprocess_newsys_keventcopyargsarc4_reinitsr_chunk_in_usewd_standbymi_switchcd9660_statfsrasops_rotate_fontsr_scsi_wu_puttsleepkern_sysctlnd6_delayin_pcbinitsys_fchmodatsqphymatchbs_notimpl_bs_rm_4Chacha20_Poly1305_Reinitnmbclust_updatehw_prodfdremovepxaudc_softintrigmp_fasttimouserconf_cmdbufwi_get_pmumass_bbb_stateohci_device_ctrl_abortxin_rootonlycdce_startapmioctlusbd_port_disown_to_1_1uvm_map_entry_poolcrgetunp_bindtcp_delackcsignalreaddisklabelvm_map_unbusy_lnusbd_clear_endpoint_stall_asyncwskbd_set_displayvirtual_availbs_notimpl_bs_rr_2tcpstatpledge_adjtimea4x_bs_r_2dma_constraintuvm_anon_poolicmp6_mtudisc_timeoutfillmapentrytcp_timer_persistugl_intrwsemul_vt100_output_esc_hashcpufunc_ifarudav_newbufsys_umask_tr_flush_blockpow2dividesyn_cache_reaperieee80211_find_rxnodefilt_fileattachsysentcpuset_addpmap_alloc_specialsbs_notimpl_bs_r_8tcp_setpersistufs_ihashlookupscsi_inquire_vpdicmp_rediracceptmemmoveapmcloseure_matchusbd_get_hub_statuswsemul_vt100_detachural_attachip_outputrefcnt_rele_wakebpf_mtapnkmempages_maxfindblknamekue_rx_list_initpool_inituvn_referencelcd_ioctlpcmcia_card_attachuvm_pmr_addr_RB_PREVrt_sendaddrmsgbpfreadbio_errorpxaudc_ep0_intrarpinvalidatepool_putm_copym2cd9660_kqfiltersr_raid5_addiobuf_alloc_pagessysctl_structbufqs_stopunhandled_afaxe_ifmedia_stsif_input_localsysctl_rdstringuvn_attachsdmmc_send_if_condlasttimesr_wu_putsysctl_disklockcnkqfiltermountroot_config_queuebs_notimpl_bs_r_2ufs_pollsr_raid5_writepmap_map_sectionmsdosfs_readlinkpmap_devmap_bootstrapieee80211_decryptusbd_get_device_statussdmmc_verbosenchinitexec_mapsnprintfcomcngetcext2fs_readlinkether_ioctlumass_bbb_transfertqphy_servicescoop_pcic_functionsip6_forwardingsys_dup3sr_shutdownural_cdkue_resetrasops_isgray_bus_dmamap_load_mbufwdc_print_capssdmmc_io_write_1wi_watchdog_usbcd9660_ioctlin_pcbnotifyalluvm_pglistallocsyn_cache_addohci_device_ctrl_transferwsdisplay_addscreenbuf_kva_enduvm_map_splitentryvm_map_lock_lnincoreurlphy_cdhzusbf_attachdefrouter_resetcd9660_ihashinssched_exitcheckaliasdl10019_mediachangettyretypestartuphook_listsdmmc_card_detachpte_l1_s_cache_modeuvm_pmr_remove_addruaddr_pivot_poolkue_detachrt_timer_queue_changepool_p_alloclf_initwi_ioctl_usbcpu_attachwdc_preata_drivemii_phy_matchpxaudc_cdural_amrr_timeoutzlibVersionrasops_list_font_cbzapm_enable_chargingsdclosevop_generic_kqfilterzts_attachpffasttimoinitsiginfosys_getuidcomconsunitcpuidsexec_setup_stackuao_createskip_nodesensor_detachbuf_mapaue_lock_miiidentify_arm_cpuffs_realloccgcdcef_newbufure_detachwskbd_load_keymapxscale_cache_cleanD_rngm_clpoolpxaudc_zaurus_cacd9660_bufatoffgroupmemberuvmspace_initscsi_plug_detachether_sprintfmsdosfs_unlockselwaitpmap_init_l1icmp6_mtudisc_callbacksnd6_slowtimosys_forkbufq_implsip_setmoptions__qdivrempmap_deadproc_cache_statepxagpio_reg_readspec_openpmap_vac_me_kpmapmld6_checktimerswcr_sessionsfilt_bpfreadsr_disk_attachwsdisplay_emulinputuvm_fault_wireusbd_abort_pipepcmcia_ccr_readkernelstackicmp6_mtudisc_timeout_qcrypto_initvm_nphysseguhidev_get_report_async_cbip6_randomiduvm_pseg_initsrpl_rc_initproc_filtopself32_os_pt_notewdc_print_current_modesSHA512Transformfiledescopensys_vforkpmap_vac_me_usercomcnspeeduvm_pager_initcpufuncswinChkNamepxaip_matchdvd_read_copyrightieee80211_recv_4way_msg1sys_getlogin_rbio_delegate_ioctluvm_pmr_addr_RB_MINMAXnd6_rs_detachuvm_uarea_freepxapcic_scoop_casys_mkdirdl10019_media_finiaxen_watchdoguao_reference_lockedcom_resumepmap_devmap_tableufs_fhtovpcrypto_donewskbd_translatedumppcbusbf_string_descriptorrttrashtargetpagesohci_root_ctrl_abortmblowatrasops_rmaskgetnewvnodeufs_inactivekue_load_fwnd6_mmaxtriessingle_thread_waitsys_socketusbd_request_async_cbffs_cgreaduvm_mmapanonwi_init_usbwsemul_utf8_translatevm_map_lock_try_lnzssp_read_ads7846spec_close_clonevop_generic_bwritenanotimescsi_detachfdt_next_propertyufsspec_writelxtphy_casd_read_cap_10iso_disklabelspoofpcmcia_cafdfreeuvn_detachieee80211_ccmp_set_keyuvm_km_valloc_trytty_countugl_cdhidkbd_detachdeflate_globalpxaudc_intrraw_disconnectpxaudc_ctrl_closemsdosfswrite_filtopssensor_task_registerusb_attach_roothubip6_neighborgcthreshbufkvmKERNEL_BASE_virtpxaohci_activateremove_coproc_handlerumass_polled_transferdeflateSetHeaderuvm_pmr_extract_rangesensor_attachbrelvpgpio_strobe_pins_c3000msdosfs_mountfsvfs_relookupuvm_map_addr_augment_getsys_utracencpusfoundwi_stopzts_ioctlsync_fsyncure_rx_list_initsetstatclockratecd9660_strategyuserconf_parserrw_initpxaudc_intr1ext2fs_allocif_input_processzapm_ac_onpmap_cachevivtwskbd_deliver_eventcom_fifo_probeieee80211_delba_requestrtable_walkskip_propertybread_cluster_callbackfdcopypxapcic_event_processin6_proto_cksum_outbpf_d_refbuf_acquire_nomapAES_GMAC_Finalrtable_matchb_to_quvm_pmr_size_RB_INSERTin_len2maskbus_space_read_raw_multi_2ugl_startpxa2x0_lcd_setup_rasopsscoop_set_irledusb_blk_freelistudp_sendspacerasops_alloc_screenscoop_gpio_pin_readuvm_objtree_RB_PREVifg_headvfs_rootmountallocSHA1Updatecue_tx_list_initaxen_iffbs_notimpl_bs_sr_2pool_wait_freecd9660_openrw_initwsemul_vt100_output_dcsglass_consoleAES_GMAC_Reinitsr_uuid_generateohci_root_ctrl_startvm_map_busy_lnbuf_rb_bufs_RB_FIND_bss_end__ext2fs_blkprefwi_alloc_nicmem_ioicsphyattachscsi_activateuhidkqfilterVOP_ISLOCKEDsys_kqueueAES_GMAC_Initieee80211_tree_RB_REMOVE_COLORuao_referencein6_addrscopebuf_getsys___threxitieee80211_ifdetachapm_get_eventbs_notimpl_bs_wm_4in_remove_prefixvfs_getcwd_scandirmaxlockdepthwi_usb_tx_unlockieee80211_free_noderaw_usrreqnblkdevuhidev_detachbs_notimpl_bs_wm_2sr_crypto_hotplugttyinputscancukbd_consopsbiodonefdt_node_property_intszssp_activatedehashkeyicmp6_rip6_inputwi_usb_txfrmsmsc_encapmaxslpext2fs_makeinodepool_requestsys_chflagsatcue_startaue_csr_read_2ufsread_filtopsufs_symlinkm_dup_pkthdrsr_crypto_assembleufs_mkdirvfs_getcwd_getcacheusbd_get_no_altssdmmc_initural_newassocaxen_attach_length_codenamecache_rb_cache_RB_PREV__anddi3phtree_RB_REMOVE_COLORrt_missmsgVOP_BMAPip_dooptionsvn_lockcue_tick_tasktimeout_add_tsrip6_ctlinputscsi_link_shutdowncdce_caSHA384Initwsemul_vt100_handle_csiumass_cbi_adscsbdropsr_meta_native_attachmsgbufphysusbd_desc_iter_nextscoop_discharge_batterytcp_debugusbd_transferinpcb_poolohci_pollohci_hubdnextralocwsmouse_touchsmsc_miibus_writereguvm_addr_fitspaceblf_keysys_setegidbus_space_write_raw_multi_4wdc_wait_for_statusnd6_inusern_matchpledge_protexeccd9660_symlinkautoconf_verbosein6_setpeeraddrunp_externalizesys_munlockalluvm_faultscoop_led_setrandomioctlsoftraid_disk_attachsoreceivepxaudc_connect_intrpool_getuextralocsdmmc_discover_tasksharp_zaurus_C3000scsibus_printlinkudav_csr_read1ieee80211_eapol_key_inputohci_root_intr_startffs_dirprefif_enqueuerip6_outputinflatescsibus_cdin6_get_rand_ifidndflushpxaudc_allocxcompose_tab_cmppxa2x0_lcd_start_dmaieee80211_parse_wmm_paramsrn_insertspec_pollif_rxr_getbpf_wakeupfilt_kqdetachaue_unlock_miiwsmux_getmuxipsec_exp_bytesdosendsyslogconfig_defersys_faccessatgf_mul_bus_dmamem_allocm_tag_initbsearchif_attachm_dup_pktghash_update_miif_deactivatesr_crypto_free_resourcesugl_casys_setrtablelcd_get_brightnesssr_raid_read_capfontlistuvm_map_addr_RB_REMOVE_COLORuvm_anwaitnameibs_notimpl_bs_sr_4uvm_map_setup_entriesext2fs_readdirip6_ctloutputdead_pollpte_l2_l_coherenttqphy_funcswihap_initversion_bus_dmamap_syncuvm_pmr_remove_sizelzs_dummybuf_needvakqueue_initieee80211_wep_delete_keyure_tickaxe_rx_list_initata_dmaerrieee80211_bip_set_keyuvm_pagezeroin6_setsockaddrigmp_leavegroupcom_common_getcaxen_cmdbs_notimpl_bs_rr_8mountlistuserconf_histbufsys_getdentscomsoftwihap_mgmt_inputudav_initconfig_deactivateVOP_REVOKESHA256Finalclallocbiowaitusbf_insert_transferfilt_ufsreadrasops_vcons_cursorunixswuvm_objtree_RB_INSERT_COLORsccstqphy_cawsdisplaymmappmap_updateccpumq_purgepxa2x0_gpio_intr_maskgeneric_bs_sr_1hidkbd_inputprocess_zapsr_raid6_wu_donertable_allocfdinitboothowtoarc4randomnsphy_funcsure_unlock_miitcp_delack_ticksupl_stopttopenata_get_paramsukbd_apple_iso_mungeip6_randomid_initieee80211_tx_ba_timeoutether_ipmulticast_minconfig_rootsearchrip6_sendspaceieee80211_countrycode2nameuao_dropswapenxiosys___getcwdcd9660_specvopsusb_cdwsdisplay_switchtoconsolepmap_enterrtmap_growamphy_funcsundefined_handler_addressRMD160Transformsys_setreuidSHA1Initusbd_ratecheckwi_usb_open_pipesudav_tick_taskuvm_map_findspacewsevent_initl1_sec_tablecomcnattachwdc_xfer_puta4x_bs_w_2sdsizeuao_dropswap_rangesblocksys_pwritevudav_lock_miikqueue_scanure_rtl8152_initieee80211_pmksa_findnet_livelockedusbd_iface_claimedtcp_closeohci_free_stdsd_patternssdmmc_disablescsi_initmsdosfs_advlockdl10019_mediastatusswcr_idkue_attachusbd_free_xferip6id_initidsys_utimensatfalloclxtphy_cdisohashkeydeadproc_mutexml_initpfctlinputcomcnprobephys_mapext2fs_pathconfumass_bbb_methodssoft_intrqdeflateSetDictionaryufs_lockcomintrsys_accessnsphy_statusuvm_swap_iouserconf_initkillpg1url_tx_list_initwsmouse_mux_openarpproxyvputonfreelistwdioctlext2fs_mountrootieee80211_findrateregyearurl_ioctlpage0setrunnableaxen_miibus_statchgwsmouse_motion_syncpxa2x0_pi2c_closeuvm_pmr_getpageswi_set_ssidcue_ioctlzts_accessopsnd6_prefix_onlinkffs_specvopscue_attachpxa2x0_stray_interruptelf32_read_fromosversionhid_is_collectionwsmouse_setnsgphy_statuswi_usb_tx_list_initapm_power_infoin6_pcbaddrisavailfind_pfxlist_reachable_routerip6_pcboptstvtohzieee80211_get_eapol_keyphtree_RB_NFINDratecheckpxa2x0_imaskin_rtchangevfs_syncwaitudav_ifmedia_statusaue_crcieee80211_node_lateattachcansignalieee80211_up_to_acmsdosfs_check_exportlf_setlocknbigpipecue_devswsfont_map_unicharin_controlieee80211_get_addba_resprlphy_funcswsmux_srcopslmaxuvm_pagecopyphtree_RB_NEXTzssp_ic_startsysctl_quadsys_readexec_process_vmcmdskue_tx_list_initpxa2x0_pi2c_setvoltageieee80211_tree_RB_FINDifq_deq_beginmbstatuhidev_intrttyinfousbf_transferusbd_get_device_stringttyinohci_root_ctrl_donegetnulldevispidtakensr_meta_save_callbackbufcache_getcleanbufextent_destroyffs_vinitenc_xform_rijndael128if_group_egress_buildzapm_pollloop_clonerttsetwatergetcieee80211_addba_requestsr_raid6_intrfilt_apmrdetachpledge_killural_update_slotuvm_pseg_lcksr_ioctl_volpmap_enter_pvuvm_mapent_mkfreeunp_disconnectsys_listensys_mountbpf_mtap_etherpgsignalfirstcuhub_detachusbf_set_addressieee80211_ccmp_delete_keysr_failioffs_fsyncwsmux_mux_openwsdisplay_consinetdomainwsfont_findscsi_devid_wwnifq_enqueuememcpywdc_enable_intrkthread_exitscsi_req_detachpriq_deq_begincue_newbufdisk_constructpledge_sockoptvfs_unbusywsdisplay_paramrip_usrreqifq_deq_commitvm_map_upgrade_lnpledge_failpledge_chownspec_writekq_timeoutmaxsdmmc_inquiryin_broadcastfd_getfilehidkbd_set_ledsmsgbufaddrsdioctlutsnameip6_setmoptionsexit2usbf_set_configdosigsuspendaue_resetkue_open_pipesip6_mloopbackext2fs_cgupdateieee80211_send_4way_msg2tcp_update_rcvspacerddumpusbf_set_endpoint_featurecpu_setperfuaddr_rnd_poolufs_lookupufs_bmappxagpio_cdudav_miibus_readregcpufunc_dfarip6_randomflowlabelttpolldegetlogpollkthread_createin_pcbresizesdmmc_mmc_commandwdc_default_read_raw_multi_2axen_rx_list_initlogclosesd_vpd_block_limitsieee80211_kdfgeneric_bs_wr_4pcmcia_submatchinstall_coproc_handlernd6_dad_findohci_rhscudav_detachufs_strategysr_crypto_create_key_diskohci_device_requestkue_watchdogphysical_freeendcopy_statfs_infobounds_check_with_labelarc4_timeoutsr_raid1_assemblesd_ioctl_cacheext2fs_checkpathsocantrcvmoreprocess_poolip6_setpktoptfile_filtopssr_raid6_rwaf2idxbuf_unmapmsdosfs_renamesdmmc_mem_initpipe_wfiltopsure_ctl__lshldi3purge_detachedif_isconnectedpfxrtr_addsrp_initcd_load_unloadipq_poolpxa2x0_rtc_getsecsuaddr_kbootstrap_destroyaxen_encappmap_activatebuf_dealloc_membmtphy_reseticmp_input_ifconfig_make_softcpte_l2_s_prot_krunp_discardcue_csr_write_1ip6_outputwi_read_record_iouhid_caudav_rxeofwsmux_get_layoutswap_syscall_lockufs_kqfilterieee80211_newstatescsi_autoconfcheckdirsexecswwsfont_addzapm_batt_minutessr_raid0_createsdmmc_set_relative_addrnsphyter_cdwsemul_vt100_output_csiin6_are_prefix_equalin6_controlpxaudc_bulk_startuvm_pmr_rootupdateleapyearsleep_finish_timeoutsys_sigsuspendcd9660_unmountwsemul_vt100_output_scs96in_pcblookup_localswcr_authcomputertmap_dtornamecache_rb_cache_RB_NFINDtrapsignalpxaohci_enablerushjobpmap_devmap_registerrn_inithead0wd_flushcachend_defrouterblf_decfdcloseexecuvm_map_sel_limitsevcount_attachlimcopybio_doreadwi_do_hostencryptwsmouse_input_resetscoop_activatescsi_req_probeuvm_mapent_forkcopytcp_timer_rexmturl_ifmedia_changepcmcia_io_maprt_timer_initsr_crypto_rwuaddr_rnd_createieee80211_next_modeputsaxe_tx_list_initrip6statip6_id_ctxtcp_debxcnpollcd_casdmmc_task_threadsys_truncateesigcodeacphy_servicescsi_xfer_poolscoop_pcic_clear_intrarmv4_tlb_flushIDudav_csr_readohci_add_doneieee80211_tree_RB_NEXTsched_choosecpu_forkohci_add_edwdc_xfer_poolcdce_newbufsoacceptkqueue_pollcdgetdisklabellcdintruhidreadufs_createfdt_get_sizend6_freend6_optionscd9660_seeknd6_llinfo_settimersr_roam_chunkssdmmc_mem_write_blockfreqmsdosfs_unmountpool_gc_tickelf32_load_psectionnamecache_rb_cache_RB_MINMAXtaskq_create_threadarm_pcache_unifiedm_tag_nextohci_intr1msdosfs_writezaurus_udc_detachcue_resetbs_notimpl_bs_w_1exec_script_makecmdszapm_resumeieee80211_reset_erpfilt_pipedetachcd9660_rootentropy_add_ptrrgephy_statusiophyattachzts_readposne_pcmcia_get_enaddrdisk_attach_callbackselrecordffs_validatecomstopaxe_ax88772_initffs1_compat_readrip_outputrrw_exitpxaudc_bulk_methodsext2fs_accessmld6_fasttimeouaddr_rnd_insertkthread_qcdcef_txeofimaxwsmouse_matchsched_barrierohci_free_seduserconf_pdevsr_detachinflate_fastmbpoolclock_secs_to_ymdhmsaes_xts_setkeytcp_canceltimerstqphymatchrip_recvspaceroute_initswap_prioritytc_setrealtimeclockrt_ifa_addlocalwdc_get_xferpxaip_measure_cpuclockuvm_vmspace_poolpxapcic_cdpipe_createwsemul_getcharnd6_sysctlpxa2x0_setperfnd6_rs_output_timersyn_cache_putdoopenatvn_openif_clone_createifq_purgebufq_fifo_requeuesr_boot_assemblycdce_tx_list_initSHA384Finaluao_detachcpufunc_controlmallocamap_pp_adjrefauth_hash_hmac_sha2_384_192in_pcbrtentrysbunlockknote_dequeuesr_discipline_initwi_cmd_usbpte_l1_s_prot_kw__udivsi3tcp_outflagskqueue_statcdce_ioctlcd9660_rrip_analyzeohci_hash_find_tdexphymatchbuf_fix_mappingbio_unregistersys_preadvuserretsys_recvmsgpipe_statHMAC_MD5_Finalif_refvn_writesr_hotplug_unregistermtdphy_servicehidkbd_hookup_bellVOP_LINKpcmcia_megahertz_xjem1144_func0icmp_inputumass_cdvcountieee80211_get_sa_queryuvm_vsunlock_devicerd_root_sizein6_delmultistathzenc_xform_cast5route_ctloutputpxagpio_dispatchsched_idlebio_warnwdc_ata_bio_intrwskbd_cnattachvirtual_enduhidev_get_reportpxa2x0_gpio_intr_disestablishbuckstring_initdetrunccopyoutpfindbufq_peekcomconsaddrip_ctloutputif_ifp_dtoruhidev_set_report_asyncwsevent_readufs_dirbadcd9660_readdirvfs_unmountallrgephy_loopwsdisplaypollsys_renameatohci_allocxwsmouse_motioncopyrightsdattachsched_peg_curprocwdc_default_lba48_write_regtcp_timer_keepusbd_devinfo_vpsbsyncwsemul_vt100_cnattachtcp_mss_updatefree_pagesfdt_find_phandle_recurserw_enter_readvunmapbufgpio_sense_pins_c3000uvm_map_pageable_wireroute_outputrti_deletefreepidsys_geteuidpxa2x0_gpio_set_functionsdmmc_mem_single_read_blockrasops_masks_initapm_attachzaurus_main_batteryicmpmaskreplin6_pcblookup_listenmsdosfs_mknodttkqfluship6_defmcasthlimsys_munmapsdmmc_io_write_multi_1axen_stopkp_nonepxa2x0_lcd_initializefilt_solistenvsnprintfpxammc_intrpte_l2_s_prot_urwsmouse_mt_convertwsemuldisplaydevprintarplookupuvm_map_pageablechainallocwsmouse_mtstatesw_reg_startpmap_copy_page_xscalewsmouse_compat_convertsr_ioctl_deleteraidifmedia_baudrateusbd_setup_default_xferzssp_attachuvm_pagelookupsoshutdownuserconf_hist_cmduserconf_listproc_cansugidcd9660_rrip_getsymnamewsemul_vt100_scrolldownwsdisplay_getc_dummyip_mloopbackbpf_iflistKQREFwdc_downgrade_modeip6intrqaxe_newbufnd6_rs_inputscsi_activate_bussoabortif_ih_unrefusbf_clear_endpoint_haltcast_encryptunp_inocanonpathtaskq_threadhidkbd_attach_wskbdlogkqfilterip6_init2uprintfsensordev_installsysctl_ifnamesmainbus_caif_rxr_initcoredump_elf32softdep_flushworklistsys_issetugidinitclockssdmmc_decode_cidcd9660_mmapif_detachaue_watchdogwsmuxopenwdc_ata_bio_startnd6_cache_lladdrcatqsession_poolugl_txeofunp_connectuvm_pagermapinif_detached_startpool_serialugl_ioctlxscale_cache_flushD_SEscsi_probe_lunaue_ioctlirq_entryvfs_mountedoncputypefc_lookup__bss_start__usbf_alloc_xferif_downndqbtaskq_sleepVOP_GETATTRieee80211_fix_ratea4x_bs_wm_1ip6_mtudisc_timeoutieee80211_node2reqwi_usb_matchelf32_check_headergf_logeephy_cdinphy_cdttytstampural_set_txantennaieee80211_node_allocieee80211_crypto_detachpmap_unwirepool_lockuvm_pageunwirerti_fillHMAC_SHA256_Inithw_seriallcd_pxaip_caieee80211_mcs2mediawsdisplay_resume_deviceauth_hash_hmac_md5_96rt_fixgwrouteautoconf_attdetapm_thread_createOF_peerufs_chmodbufq_nscan_resortsys_o58_killcdattachuserconf_devicepledge_syscallsm_resethdrsys_sigaltstacksdmmc_cisptrsoisdisconnectingdevice_mainbusBlowfish_initstatesched_steal_procwi_media_changenull_decryptrttimer_queue_headarm_pdcache_sizedp8390_enableexphy_cartredirectnsgphy_casoftintr_inituvm_pmr_pnaddrttymodemwsdisplay_defaultscreensmtx_enteraxe_devskqueue_poolvntblinitbuf_rb_bufs_RB_INSERTcpuset_intersectioncd9660write_filtopsAES_GMAC_Setkeysleep_queue_initax88190_mii_bitbang_opspmap_preferin6_ifattach_linklocalsys_setresgidsr_crypto_encryptsdmmc_mem_read_block_subruvm_pmr_freepagesieee80211_input_bamsdosfs_sync_vnodesplassert_failarm_picache_wayspriq_freetty_initaxe_ioctlwsdisplay_clearoncloseuvm_km_freesys_killuserconf_numberperflevelcomconsiohure_resetpmap_set_pcb_pagediruvm_pmr_addr_RB_NFINDrt_setmetricssys_getegidusbf_config_descriptoruvm_objtree_RB_FINDsw_reg_iodone_internalrasops_vcons_copycolsumass_init_insystemfrag6_deletefraghdruaddr_destroydirchkexphy_resetipip_outputpipecloseVOP_REMOVEfdt_get_regconsinitsdmmc_scsi_minphysurlphy_statusext2fs_dirremoveuvm_vnp_uncachesysctl__stringure_iffffs_clusteracctconfig_detachmtdphyattachifaof_ifpforaddrcryptop_poolsensordev_listsr_checksum_printuhub_port_connectminidatacleanrt_timer_queue_destroysr_meta_probezkbd_syncieee80211_input_ba_gap_timeoutwi_cdsd_cduvm_pseg_geticmp_mtudiscipport_hifirstautoieee80211_tkip_delete_keysys_fstatlcd_show_screenufs_itimesenc_xform_3desrgephyattachuserconf_enablepte_l2_s_prot_uwext2fs_vinitumass_bbb_resetffs_alloccgbuf_object_storesmsc_wait_for_bitsgeneric_bs_w_1sa6_anysys_getprioritysysctl_diskinitsr_concat_discipline_inituvm_km_valloccdcef_watchdogieee80211_send_mgmtcue_getmacscsi_xsh_delieee80211_add_wme_infoscsi_plug_probesys_unmountsr_meta_native_probewsdisplay_activatebootdvapmkqfilterelf32_probesin6ifa_ifpwithaddruvm_pagezero_threadvgonelcrypto_taskqsofreend6_dad_timeruaddr_rnd_destroyinphyattachduid_formatcpuset_unioncomsiraddruuid_dec_beeephy_matchpmap_removebpf_mtap_afusbf_free_xferhidkbd_parse_descicmp6_fasttimouvm_pmr_addr_RB_INSERText2fs_removemtx_initif_clone_destroywdccommandcdcef_ioctlwi_pcmcia_wakeupvmcmd_randomizepxaintc_attachbpf_setfuserconf_historyuvm_page_unbusytk_noutusbpalockext2fs_mountpmap_collectBlowfish_expand0stateukbd_enableuvm_map_addr_RB_PREVwdc_xfer_getgeneric_bs_rr_4cpu_sysctlcd9660_deftstampzlibCompileFlagsip_randomidaue_tx_list_initsdmmc_io_function_disableieee80211_recv_disassocnosuidcoredumpukphyattachrasops_load_fontcddumppxa2x0_lcd_alloc_screenastusbd_claim_ifacetcp_disconnectuvmspace_execwi_usb_detachwsmux_createpxaohci_attachsys_mmapbootnd6_is_addr_neighborblf_ecb_encryptwsemul_vt100_output_normalunp_rightshostnamedisk_closepartwsdisplay_emulbellieee80211_ba_delupl_outputext2fs_bmapuvmexpenc_xform_blfbufq_donesr_crypto_dev_rwsensordev_getufs_diremptySipHashreinsertfinishdupsleep_setup_timeoutuao_grow_hashukphy_serviceqsphy_resetsmsc_stopdeflate_decompresspool_destroylogwakeupdl10019_mii_readreghidkbd_attachip_dosourceroutesoread_filtopsieee80211_media2ratedmapoolsrasops_show_screenbdevsw_lookupperfpolicydisk_changewsemul_vt100_resetopsdmmc_create_threadamap_lookupsifq_initcache_revlookupfdt_parent_nodebpfread_filtopssoinituhidev_get_report_asyncuvm_mapent_isjoinableuvmzeroin46_addrVOP_MKNODpxa2x0_update_intr_masksnd6_ifdetachin6_ifaddrroute_protopxa2x0_lcd_geometrysync_vopshw_uuidnd6_isneighborext2fs_truncatecd_play_tracksscsi_do_mode_senseuvm_pmr_allocpmrip6_maxfragpacketsax88190_media_finiprefetch_abort_handleruvm_km_threadsr_checksumscsi_probe_buslminm_leadingspaceconfig_mountrootsys_fpathconfscoop_battery_temp_adcwsmuxpollarpt_pruneohci_device_bulk_methodskp_zerosoconnect2pledge_syscallknote_poolcnopenscsi_test_unit_readyural_set_bssidnmbclustural_get_rfsominconndma_freepoly1305_initsoftraid_cdpcmcia_matchbpf_d_unrefuvm_vnp_syncusbf_end_configusbf_add_configwsmux_set_displayieee80211_get_disassocarpt_downrdgetdisklabelarm_pdcache_line_sizebpf_tapnthreadsuvm_pmr_addr_RB_NEXTnumnegmii_phy_autouvm_pmr_addr_RB_FINDuvm_mapent_free_removewsfont_rotatefdt_find_phandlemsdosfs_initohci_device_ctrl_startrtmap_limitwi_write_record_ioext2fs_writelf_clearlockpxaudc_writegeneric_armv4_bs_wr_2uvmpd_scan_inactiveurl_memip_srcrouteuhidioctlpte_l1_s_cache_masksys_setregidpcmcia_cdusbd_device2interface_handleurl_csr_read_1cpuset_infosusbd_dopollvinvalbufmii_bitbang_writeregmainbus_attachsys_ftruncateaes_ctr_cryptm_splitsoftintr_disestablishentropylockbufcache_getdirtybufurl_stopzts_irqtcp_timer_inittuagg_unlockedpool_multi_freend6_maxnudhinttcp6_inputsosetoptkp_dirtytcp_mssrt_sendmsgifa_addcache_purgeudav_stop_taskusb_detach_roothubbpf_mcopyax88190_mediachangepcmcia_3cxem556_func0comconsrateauth_hash_hmac_sha1_96pcmcia_intr_disestablishfork1vfs_hang_addrlistbuf_realloc_pagescue_tickdead_writeufs_dirrewriteinsmntquettreadtk_canccext2fs_blkfreeudp_outputfind_last_setsoftraid0pxaintc_matchsys_chmodprelist_removeuvm_objtree_RB_NFINDuao_shrink_arrayffs_vgetaxe_encapsr_bootuuidip6_getpmtu__umoddi3bcstatsin_pcblhasharm_dcache_alignvm_map_downgrade_lnip6_log_intervalnull_encryptdevice_mpathsched_idle_cpusugl_newbufscsi_activate_lunwsemul_vt100_nextlineuvm_atopgmaxprocesssyn_cache_timervt100_initchartableslcd_paramOF_childieee80211_auth_opensolisten_filtopsprocess_kernel_argsin6_update_ifa__wdcerrorSHA384Updatecdce_detachpxa2x0_intr_disestablishrt_msg2suser_ucredcom_is_consolemem_noext2fs_buf_allocdp8390_startbufbackpagesuaddr_kernel_functionspmap_free_l2_bucketRMD160Update_intrevarprequestkernel_maprrw_enterwi_init_iodumpdevwsmouseioctlcd9660_lockusbd_ref_incruvm_mapent_forkzeroieee80211_mgt_subtype_namegf_powuvm_pmr_splitvfs_mount_foreach_vnodekqueue_kqfiltertimeout_add_usecsr_raid5_set_chunk_statewi_mgmt_xmituhid_do_ioctlzeroin6_addrstrncasecmptimer_filtopsohci_device_bulk_starttcp_mss_advSHA512Update_intzts_cdcurrent_spl_levelnd6_optionwin2unixfnmax_hdrffs_readifq_enqueue_trym_freepool_allocator_multi_niphtree_RB_FINDpxaudc_ctrl_startne_pcmcia_dl10019_get_enaddraes_key_wrapurlphy_attachieee80211_get_assoc_reqsr_meta_attachsr_meta_native_bootprobescsi_inqmatchfdesc_poolpool_page_allocsr_switchm_tag_delete_chainfilt_pipewritecd9660_pollugl_detachbadaddr_read_4Chacha20_Poly1305_Setkeybzeromii_bitbang_syncumass_scsi_probearmv4_drain_writebufswapdrum_addufs_closedefrouter_delreqfixjobcsdmmc_matchuvm_pmr_size_RB_REMOVEusbf_set_endpoint_haltscsi_devidin6_addmultirn_newpairbioszts_enable__udivdi3sys_obreaksdmmc_intr_enablepxapcic_attach_cardpxa2x0_gpio_set_intr_levelblf_setkeyusbd_set_config_norgephy_cdieee80211_pmksa_addlastddateuvmfault_unlockallsr_meta_getdevnamem_inithdrpmap_curmaxkvaddruvm_pmemrange_addr_RB_NFINDuuid_dec_lein6mask0bpf_validateusbd_get_string_descvaccessuao_set_swslotsys___thrsigdivertsys_getdtablecountmbinitsr_errortcp_secret_ctxabortwskbd_default_bell_datascsi_readsafe_cmdieee80211_set_link_stateamap_allocVOP_LOCKbuf_rb_bufs_RB_INSERT_COLORMD5Finalwskbd_matchaxe_rxeofcd9660_vget_internalwi_intrvgetrd_attachkd_nowaitpxa27x_cpu_speed_91wsmouseopenwinChksumbufq_requeuefreeclusterchainmld6_initswapmapscsi_get_linkdisk_initpxapcic_intr_establishSHA256Updateohci_bus_methodsohci_hash_rem_itdrip6_ctloutputdisk_readlabelaue_sendusbd_getnewaddrrasops_erasecols_rotatednd6_na_outputext2fs_fhtovpsr_validate_stripsizeumass_cbi_transferext2fs_createunp_deferredwi_sync_mediapte_l2_l_prot_maskuvm_map_teardownpipe_pollpool_reclaim_allnsphy_cabmtphyattachsysctl_dopooluhub_matchuvm_mapent_clonetcp_respondsys_readvcrypto_getreqamap_cow_nowroundrobinusbd_get_hub_descriptorsa11x0_intr_establishbadaddr_readuvm_map_createissignalwdprintsr_attachfilt_uhidrdetachin6_selectrouteieee80211_recv_rsn_group_msg1rtmap_initcdevvpscsi_pending_start_setsoftintrmsdosfs_kqfilterfdt_find_nodeigmp_joingroupuiomoveohci_device_isoc_donewi_usb_wridrespmsdosfs_startlf_alloccpu_idle_leavewi_intr_ackscsi_iopool_getbpf_reset_dnd6_dad_stopdiskmapioctlhid_start_parsescoop_pcic_socket_setupinflateSyncPointuvm_waitskip_node_namefilt_apmreadnexecsmclpoolszts_avgposieee80211_regdomain2namepmap_referencesys_bindax88190_mii_statchgsdmmc_done_xsloioctlrw_exit_writebs_notimpl_bs_wr_8ieee80211_eapol_key_micrt_ifa_addusb_abort_taskspmap_bootstrapbs_notimpl_bs_wr_2blf_cbc_encryptsys_mqueryarm_picache_line_sizekmeminit_nkmempagesspeedtablesusbd_new_devicewi_pcmcia_detachuvm_pmr_size_RB_REMOVE_COLORscsi_iopool_initscsi_io_putunp_gc_taskure_devsuvm_pmemrange_findfillinusemaprecvitbmtphy_funcsusbf_get_descriptorscoop_suspendfilt_sowriteuvm_kernacccnpollcsys_linklcd_blankuvm_addr_initlog_opensr_rebuild_initfilt_randomdetachuvm_pmr_size_cmpfragtbl124userconf_totdevxscale_cache_flushIDieee80211_plcp2ratert_ifmsgrandomread_filtopsrealitexpireipstatunix2dostimedounlinkatscsibus_caurl_newbufusbd_delay_mscrfreecnputcuhid_do_writeip6_lasthdrrefcnt_finalizedl10022_mii_bitbang_opsohci_device_isoc_abortuhub_uhub_catcp_reaperpool_sethiwatwi_read_record_usbwsemul_vt100_output_c0c1wdgetdefaultlabelmicrotimeuvm_pmr_addr_cmppipeunlockuvm_pmemrange_addr_RB_MINMAXuvm_swap_getrasops_free_screenext2fs_reloadurlphy_matchbufcache_getcleanbuf_rangeelf32_copyargsisochariophymatchuvm_km_alloc1cdopentcp_usrclosednsphyter_caaue_ifmedia_stsphysmemuvn_flushsr_bio_handlerurl_cdnsgphy_servicesdmmc_del_taskuvmfault_relockinferiorukbd_attachxscale_cache_purgeD_Eclusterallocsr_raid_syncrt_if_remove_rtdeleteif_input_taskwskbd_attachin_pcbbindumass_cbi_statexscale_cache_flushImtdphy_caudp_notifysdmmc_app_commandendtsleepwihap_check_txstrnlensigactsshareuvm_map_freelist_update_refilluvm_map_addr_RB_NEXTbpfattachugl_openpipesml_purgeitimerdecrieee80211_get_delbaether_outputpmap_bootstrap_pv_page_freeamap_chunk_freeinflateGetHeaderbpfilter_lookupm_copym0sdmmc_io_detachaxe_miibus_readregpxapcic_detach_cardvm_physmemiso_shipdirrdwriternd_timeoutieee80211_setup_htopieee80211_parse_edca_paramspipe_ioctlfilt_timerexpireural_set_chanwskbd_enablepmap_devmap_find_vacd9660_mountrootusbf_devinfo_allocbpf_allocbufsaxen_tx_list_initset_stackptrmsgbufmappedohci_device_setintrpxapcic_attachcomprobe1cdsizeumass_lookupsmsc_attachwsmouse_mux_closewakeupuao_growgetnanotimewdc_pcmcia_disk_device_interface_callbacka4x_bs_wm_2pxaudc_ctrl_transfertcprexmtthreshkprintf_mutexusbf_alloc_bufferieee80211_ht_negotiatert_getifawi_get_fid_ioenosysrtlabel_name2idhidkbd_is_consoleuvm_vnodeopsvfsconfusbd_detachVOP_OPENcompwroffwsdisplay_console_inittedbuckstringusbd_fill_deviceinfoscsi_interpret_sensesqphy_cdext2fs_flushfilesunp_headdes_ecb3_encryptieee80211_send_eapol_keymallocarraycomconsattachedlxtphyattachwi_usb_txeof_frmufs_readlinkrdopenin6_ifadddoscheckpathsyslogfpcbmap_tr_stored_blocknd6_option_initbufq_quiesceext2fs_setsizein6_init_prefix_ltimesnchstatscd9660_fhtovpmsgbufpfdt_parent_node_recursesys_setgiduserconf_common_attrfilt_ufswritezts_activatert6_flushpxapcic_io_freepledge_recvfdgeneric_bs_r_4pxaudc_epN_intrmmrwieee80211_media2mcsffs_bufatoffwi_usb_rridrespfilt_msdosfsreaddohooksgf_invieee80211_rssadapt_choosenprocessespool_p_freeif_detached_ioctllocnamppsegswi_usb_caure_miibus_writereguserconf_showconfig_suspend_allip_mtudisc_timeout_qsr_raid5_assemblesr_scsi_cmdaddress_exception_entryffs_fhtovpitimer_mtxgetvnodefilt_ufsvnodecrypto_get_driveridin6_pcbhashspeed_to_freqpool_setlowatkmembaseswi_entryrip6_inituvm_aiobuf_poolisofncmppcmcia_card_detachseltrue_filtopssys_sigprocmasksysctl_mqfilt_pipereadpxa2x0_intr_establishenc_xform_aes_gmacsoreserveconsoleusb_activatepxaost_attachscsi_report_lunsufs_quotactldosymlinkatuvm_map_uaddraroundin6_pcbnotifyif_ih_insertusbd_clear_endpoint_toggleexplore_pendingstrrchrin_pcbselsrcgetdevvpm_clgetdefrouter_selectamap_unrefext2fs_statfsbpf_mtap_hdrcrdupamap_wiperangecuio_copybackisodirinocfrootswsmousepollchrtoblkscsiprintuserconf_pdevnamminphysukbd_matchurl_ticksys_fchownatztsavgloadedether_addmultitimeout_mutexieee80211_recv_actioncdce_cdffs_vptofhvfs_isbusyifunitirqstackbawritetputcharwskbd_detachpmap_postinitffs_fragacctpxa2x0_lcd_resumeffs1_ballocsys_fchowninflateInit_SHA384Update_intvwaitforiopxagpio_camii_phy_ticksdmmc_io_function_enablecd_read_subchanneluao_shrink_flushflsextendfilelortrequestwsdisplay_resumeicmp6_inputwsemul_vt100_outputbuf_valistuserconf_addsdmmc_io_write_4ohci_device_intr_methodswi_func_iocreatedefilt_randomreadieee80211_michael_mic_failuresbreleaseuvm_wxabortin6_selectifmsdosfs_islockedmax_linkhdrumass_attachwsdisplayioctluvm_unmap_detach_intrsafewdc_xfer_iopooludav_resetget_stackptrsysctl_rtablemsdosfs_reclaimsr_rebuild_percentwdc_free_queuesqphy_serviceuserconf_hist_eocsys_readlinkatuvm_objtree_RB_REMOVEext2fs_getattrrtlabel_id2nameusbf_setup_default_xfersbdroprecordinitconsbufpxaip_searchwdsizenamecache_rb_cache_RB_REMOVEsdmmc_io_scanacphy_statusip6_sysctlsuserusbf_devinfo_setupdiskconfural_tx_datavn_syncer_add_to_worklistusbd_get_interface_descriptorgeneric_bs_rm_1pxaudc_activatetk_ninsysfilt_opssdmmc_io_function_readyclusterfreefilt_randomwritesr_warnsr_raid_intrieee80211_alloc_node_helperrootdevm_tag_firstpxa2x0_cpu_resumecdmatchpmap_map_entryusbd_get_config_descriptorpfxrtr_deldumpsysicmptstampreplrip6_sysctlext2fs_fsyncsys_fsyncwi_usb_stopuserconf_add_readsr_crypto_writeusbd_reset_portifconfcpu_apmwarnamap_wipeoutuser_configcast_setkeytcp_outputnsphyattach_bus_dmamem_mmapwsdisplay_emul_attachsdmmc_mem_read_blockupdate_ledsext2fs_updatert_ifa_dellocalpxa2x0_memcfgtcp_timer_2mslne2000_writememaue_openpipesffs_reload_vnodebuf_putmsdosfs_setattrVOP_RMDIRsr_ioctl_installbootif_addgroupieee80211_setmodeuhid_matchpool_allocator_freefilt_proceopnotsuppsdmmc_enablephtree_RB_INSERT_COLORrandomcloserootvpaxe_miibus_writereguvm_pmemrange_addr_RB_NEXTpxagpio_intrlowieee80211_eapol_key_decryptpcmcia_intr_establishrt_plentosauserconf_maxlocnamespool_reclaiminitdisklabelure_tick_taskusb_quirksbpf_insn_gcbpf_sysctlvflushieee80211_bip_encapcddetachpmap_clear_modifytcpctl_varsarptimerbufq_dequeuetcp_reass_limitm_copymruaddsys___set_tcbrdstrategybcopy_pageip6_freepcboptsif_netisrif_upcoredump_notes_elf32timeout_add_nsecuvmfault_lookupif_idxmap_insertm_extfreene2000_ring_copysdmmc_set_bus_powerrgephy_resetupl_intrural_matchdeflateBoundVOP_BWRITEbufq_fifo_peekrt_timer_queue_createwddonemsdosfs_ioctlupl_matchno_constraintmsdosfs_dehashsys_opensr_crypto_change_maskkeywdc_alloc_queuergephy_funcsusbd_match_devicerasops_pmaskinet6domainural_enable_tsf_sync_bus_dmamem_alloc_rangeether_crc32_be_updatepgdeletepxapcic_intr_stringsdmmc_io_initusbf_do_requestwskbd_do_ioctl_scdead_vopsifq_q_leaveieee80211_media_changeuaddr_hint_createraw_attachural_set_rxantennahidkbd_cngetcscsi_ioc_cmdmax1111_adc_value_avgastpendingifnewlladdrether_ip6multicast_maxpipe_pooluao_initudav_iffsdmmc_needs_discoverifa_ifwithroutescoopattachspec_kqfiltertcp_notifyieee80211_match_bsscd9660_tstamp_conv7ural_free_tx_listffs_dinode1_poolieee80211_set_keyieee80211_bip_delete_keyrtflushclonegetblksr_raid_turdl10019_stop_cardxscale_cache_flushD_rngmaxsmapwdc_ata_bioip6_mcast_pmtusoconnectural_initrasops_use_fontwskbd_repeatroute_arp_conflictuvm_map_fix_spacenobuffers__lshrdi3data_abort_handler_addressin6_delayed_cksumusbd_errstrSHA256Update_intsr_scsi_ioctltcp_identtcp_rst_ppslimrtrequestifinitsd_cmd_rw10cd_load_tocOF_parentunpst_recvspaceuvm_map_mqueryget_ifidsr_infoscsi_io_getne_pcmcia_attachkue_initxscale_cache_purgeIDuvm_map_kmem_growraw_inputcd9660_reclaimkue_ioctlfilt_logrdetachtimeout_add_btnd6_ifattachunpdg_recvspacedofaccessatpipe_closecd9660_inactivesoftdep_mountmsdosfs_rmdirmsdosfs_fsynccfdatadeflateInit_ffswi_usb_tx_lockufs_checkpathSipHash_Finalcdcef_rxeofpmap_pte_init_xscalepfxlist_onlink_checkdiskmapreadm_tag_findinittodradler32blf_encvputaue_iffpte_l1_s_cache_mode_ptvector_page_setprotcd9660_setattrusbd_get_configpool_allocator_multiwsmouse_id_to_slotuaddr_kbootstrapufs_quota_initallocpidkqread_filtopsusbd_setup_pipexscale_setttbaue_csr_read_1pcmcia_check_cis_quirksxscale_cache_cleanIDbuf_acquiredolinkatbioopscpu_classesbpf_setdlttcp_flush_queuepool_setiplmsdosfs_statfsbuf_adjcntlboltpipe_inituvm_wait_plausbd_open_pipe_intrusbd_request_asyncaes_gcm_reinitsyncerprocpcmcia_card_gettypepxa2x0_clkman_iohufs_ihashinszcfreein_setpeeraddrinphymatchpxa2x0_a4x_bs_tagwindow_inflatewsdisplay_delscreenpool_multi_alloc_niether_ifdetachsr_meta_native_readuhidev_get_report_descuserconf_histcursdmmc_mem_write_block_subrmsdosfs_inactivepanicstrrasops_wronly_copycolswsdisplay_kbdinputupl_newbufumass_scsi_cbscsi_delayext2fs_sync_vnodeif_startunpdg_sendspacesession0viscpywsmouse_do_ioctlrasops_wronly_eraserowsChacha20_Poly1305_Finalhw_ver__umodsi3copyincomparamural_stopudav_sendcd9660_defattrohci_device_bulk_closebs_notimpl_bs_sm_8uao_swhash_elt_poolufs_ihashgetne2000_read_hdrdovchflagssigacts0scoop_mmc_attachfindblkmajormsdosfsvnode_filtopssdmmc_mem_decode_scrrasops_vcons_mapcharpte_l2_l_prot_urntohlsorflushiophy_funcsusbf_create_threadlcd_matchuvm_mapent_tryjointtioctlvprintfslpquesr_raid1_wu_doneohci_root_ctrl_methodsttycharssyncdelayuvm_vslock_devicewi_usb_infofrmaxen_ioctluvm_pagealloc_multisdmmc_io_read_2hidkbd_enableffs_mountwsmux_mux_closechacha20_setkeyif_ifp_gcicmp6errppslimbadaddr_read_2rt_plen2maskmsdosfs_vopsdp8390_mediachangeconfig_process_deferred_childrenbufq_waitohci_ifcdwsdisplaywriteieee80211_add_htcapssdmmc_decode_csdxscale_cache_purgeID_Ebs_notimpl_bs_sm_2ifq_q_entermsdosfs_rootmii_bitbang_sendbitstqphyattachbpf_getdltlistm_tag_getuvm_shareuvm_map_freelist_updateohci_root_intr_abortrt_labelscrypto_unregisterHMAC_SHA1_Finalupl_watchdogsuid_clearttwritedma_alloc_initifq_dequeuebuf_rb_bufs_RB_NFINDbuflowpagesrebootswapdev_vpdp8390_resetpool_gc_taskpxa2x0_bs_mapaes_xts_cryptieee80211_deliver_datadead_readkv_execusbf_reallocpxapcic_socket_disableufs_pathconffile_poolohci_timeouture_newbufunputcendpcmcia_verboseVOP_CREATEcpuset_firstSHA512Updatecdce_stoppledge_nameirasops_copycharnd6_recalc_reachtm_intervalin_ifinitohci_device_ctrl_closewi_pcmcia_activatein_pcbhashlookupsys_mknodatapmread_filtopskp_dmaural_writehid_get_data_subVOP_ABORTOPrasops_vcons_eraserowsdofchownatsr_wu_done_callbackfilt_wseventreadsys_acceptnsphyter_statuspxa2x0_pi2c_writeuvm_map_entry_kmem_poolieee80211_wep_decryptrtable_lookupuvm_pagerealloc_multiwi_inquireuaddr_bestfit_pooltcp_rst_ppslim_countieee80211_recv_assoc_respieee80211_parse_rsn_bodyukbd_detachaes_key_wrap_set_keyif_clone_listtc_windupsys_futimessdgetdisklabelwi_do_hostdecryptinternal_commandumass_scsi_detachuvm_map_boundaryin_losingaxen_rxeofVOP_SYMLINKgeteblkusbd_set_interfacewsscreen_detachscsibusmatchinflateBackInit_vn_ioctlwi_usb_ctl_lockufsspec_readieee80211_input_ba_seqaxe_cdpipespacehid_get_udatafiqvectorget_last_resort_ifidohci_alloc_stdip6_sendredirectscast_decryptukphy_caitimerfixpxa2x0_apm_attach_subip_stripoptionsieee80211_add_xratesusbf_errstrnd6_timer_chugl_rxeofne_pcmcia_ax88190_set_iobaseuvm_pseg_releasecpu_resetudav_ticktcp_ctlinputether_multiaddrstart_cleanerffs_blkfreewsmouse_buttonsexit1ohci_detachwsmouse_add_muxihashkeybdevvpifa_ifwithdstaddruvmspace_dusedudav_ifmedia_changein6_nigroupscsi_mode_sense_big_pagesys_mkfifoatpool_get_doneuihashpxaudc_read_epNrijndaelEncryptscsi_ioh_deltcp_keepintvlifq_priq_opscdwriteufswrite_filtopsttybgconfig_searchzts_samplesphtree_RB_PREVusbd_printscoop_set_backlightuvm_km_valloc_prefer_waitsyn_cache_poolffs_allocaue_tick_taskeephy_funcsinphy_funcsrgephymatchbswap32ipsec_exp_first_usecdcef_cdrlphy_servicenet_livelocksplimit_poolip6_defhlimumass_setup_ctrl_transferunp_connect2usbd_set_pollingpxa27x_frequency_changern_walktreesys_chownuvm_pagewireukbd_apple_iso_mba_mungerasops_putchar_rotatedin6_joingroupsys_munlockinflateBackuvm_anfreert_ifa_deldofilereadvipip_sysctlbs_notimpl_bs_sr_1vn_statfileieee80211_iterate_nodesrw_exit_readwi_intr_enabletablefulluhub_exploreupl_txeoftcp_maxidlescoopmatchvfs_getcwd_commonset_cpufuncscttyioctlsys_lstatscoop_gpio_pin_ctlieee80211_recv_wpa_group_msg1ieee80211_recv_addba_respohci_timeout_taskohci_hash_add_tdieee80211_tkip_set_keyiso_uiodircttykqfiltercttyopenpmap_link_l2ptinet6ctlerrmappool_runqueuedisknameslenicmp6_redirect_diagdisknamessched_queued_cpusumass_quirksdumploRMD160Updatemsdosfs_mountacphy_funcsmq_dequeuenullcnpollcuvm_km_inituvm_objinitbzero_pageffs_sbupdatechillbufsudp_sysctlsys_openatax88190_mii_bitbang_readbs_notimpl_bs_wm_1vmmapbsyusb_add_taskurl_int_miibus_readreguserconf_histlenbufcache_initnkmempages_minukbd_accessopspxapcic_io_allocusbcloseudav_matchpxauart_matchvector_pagekq_ntimeoutssys_sched_yieldvmspace0scsi_decode_sensettywaitwsmousedevprintuvm_map_setupwdc_default_vtbluao_grow_arrayuvm_uarea_alloclcd_set_brightnessetextifa_ifwithnetmemchrohci_device_ctrl_doneqsphy_statussrp_swap_lockedsqphyattachpte_l2_s_cache_maskcomp_algo_lzsieee80211_recv_barrn_link_dupedkeysysctl_cptime2sdmmc_capxa2x0_bs_unmapscsi_mode_sense_pageboot_argspipelockvt100_selectattributepxammc_clock_startproc_poolaue_intrudp6_inputsys_writeural_set_txpreamblesharp_zaurus_C3000_blgeneric_armv4_bs_rr_2sb_maxusbd_fill_iface_datacd_set_pa_immedsr_uuid_print__bss_end__wsdisplay_maxscreenidxip6_insertfraghdrresume_randomnesscnstopihashtblieee80211_set_shortslottimesys_dup2gpt_chk_mbrwsdisplay_switch1wd_get_paramsrtable_init_backendbread_clustersys_readlinkext2fs_size__ashrdi3bs_notimpl_bs_mmapzErrorohci_intrxscale_cache_flushI_SEip6_auto_flowlabelcrc32devid_copylf_splitifafreeVOP_STRATEGYtimeout_add_sectzpxammc_card_intrxscale_cache_syncIOF_nextproprip_sendspacecoredump_writenote_elf32uhidev_writeusb_generic_tasksxscale_cache_cleanID_rngamap_addtcp_freeqif_setgroupattribscom_attach_subrdvd_authSipHash_Updateexphy_serviceumass_scsi_cmdscoop_gpio_pin_writecdreadrasops15_initspec_inactivedp8390_stopwi_func_usbwsmux_do_ioctlsys_sendtoicmperrppslimgeneric_filtopsrefcnt_initknote_dropcue_watchdogin6_selectsrcuvm_mmaplockrd_casdmmc_read_cissoftclock_siwi_usb_threadugl_watchdogsr_ccb_putzkbd_ioctlnd6_rs_output_timeoutalldevsdp8390_rintwddumpicmp_do_errorvmcmd_map_readvnsmsc_initpxammc_exec_commandrandom_startcomconsfrequsbd_get_interface_altindexsigpropvmapbufumass_scsi_switchdehashtblsocketopsscsibus_bioctlpcmcia_activatend6_maxndoptuvm_map_clip_startffs_fragextendtcp_always_keepaliverawcbtablespec_readunp_markacphyattachicmp_mtudisc_timeoutnwsmuxa4x_bs_r_1pmap_zero_page_xscalettyread_filtopsuvm_mapgetinoquotascsi_do_ioctlrtable_existsndinitatdisk_lock_nointrcd_resetscsi_ioh_addext4_ext_find_extentscsi_detach_busudpstatroute_inputsetrootcsr2cd_read_tocural_amrr_updatecdioctlieee80211_defrag_timeoutbufq_switchcue_stopifmedia_addfrag6_queuelxtphy_funcssr_matchusbd_set_config_indexlogopenieee80211_add_rsn_bodyfdt_check_headrn_del_radix_masksr_raid6_initcd_buf_donescsi_devid_pg80rtable_insertbreadntcp_hdrszscsi_devid_pg83tcbtablefilt_cd9660detach__xordi3frag6_drainuvm_objtree_RB_REMOVE_COLORdosdiremptyigmp_slowtimoifpromiscrtl80x9_mediachangerasops4_putcharip6_setpktoptsfork_returnsys_getsocknamecd9660_lookupsr_concat_initwi_usb_intrusbd_alloc_bufferinflatePrimemask_rnheadbpf_mbuf_opswsmouse_matchingsw_reg_iodonepte_l2_s_protoufs_rootsdmmc_detachtcp_sysctlVOP_SETATTRsmsc_chip_initsrp_update_lockedwsmouse_btn_syncpmap_kremovesigactsinitsdmmc_io_rw_extendeddomknodatcpu_kcore_hdrexec_elf32_fixupvop_generic_lockwsmouse_mtframecomconsiotuvmfault_anongetconsttywdc_pcmcia_caural_bbp_readpxammc_host_resetsr_ioctl_diskext2fs_dirrewritevn_closefile__ucmpdi2umass_discoip_mtudiscvfs_free_netcredmld6_start_listeningcpu_mainbus_cakue_matchpmap_kenter_papidhashtblaue_matchuvm_mapent_forksharedm_pullupenterpgrpwdc_pcmcia_lookupxscale_tlb_flushID_SEcrypto_freesessionwsemul_vt100_output_string_escwsdisplay_kbdholdscrpxa2x0_rtc_getalarmcnbellm_copydatabpf_mbuf_copybufq_nscan_requeueuvmfault_initcd_setchanieee80211_get_probe_reqpool_p_removemtx_leavefilt_signalsigactsfreewdc_default_write_raw_multi_4ttymallocupl_attachrasops_copyrows_rotatedicmp6_notify_errorieee80211_recv_probe_respwsdisplaykqfilterbs_notimpl_bs_sm_4kue_setmultizapm_acintrmmioctlumass_matchsched_choosesendsigsdmmc_print_cisohci_device_ctrl_methodsbpf_ifnameohci_cdural_ioctlsmsc_iffvfs_busytimecounterfilt_ufsdetachbufq_initlf_getlocksr_raid6_xorpsolistenwskbd_compose_valuein6_ioctlspec_getattrip_ecn_ingressmsdosfs_bmaprip_ctloutputffs_vtblif_getgroupieee80211_parse_rsnether_rtrequestpool_debuguserconf_morekqueue_ioctlmax_processessys_wait4rip6_recvspaceieee80211_bar_tidfs_sysctlukbd_cnattachpxammc_card_detectpxaost_matchboot_filepte_l1_s_prot_uwfilt_sordetachknote_activatepsignalwsdisplay_console_confieee80211_regdomain_compare_cnconfig_pending_incrusb_task_threadamap_pp_establishauth_hash_gmac_aes_192uvm_pmr_nextszuvm_anon_initffs_reclaimbmtphy_causb_free_deviceusb_explorebufq_nscan_queuexscale_cpufuncsif_link_state_changelcd_max_brightnesspmap_virtual_spaceieee80211_add_wpaieee80211_eapol_key_check_micpage0_endieee80211_add_capinfobpfpolluvm_pmr_nfindszupdatepriohci_activatebmtphy_servicesched_kthreads_createuhid_cdwskbd_cnbellbintimevt100_decmodewi_seekfilt_soreadpmap_remove_allrtable_addmq_delistzeropageipsec_def_encrtable_deleteffs_nodealloccgsoftintr_establishpxaudc_detachuvm_pmr_removeip4_input6pdevinit__iordi3nsphytermatchwsmouse_touch_updateuvm_pmr_findnextsegmentinetctlerrmapresetpriorityusbf_device_descriptorenoioctlwi_usb_start_threadaxen_ifmedia_stsrasops_vcons_copyrowsflslsigacts_poolexecsigsconfig_initicmp6_redirect_inputbuf_rb_bufs_RB_REMOVE_COLORrw_enterOF_is_compatibleaue_read_macuvm_addr_destroysr_raid0_inituvm_pmr_size_RB_MINMAXskip_nopsnd6_ra_inputffs1_blkprefOF_getproplenin6addr_loopbackuvm_objtree_RB_MINMAXttypendin6addr_linklocal_allroutersuvm_swap_freepagesqsphymatchnd6_dad_starttimerin_revarpinputstrlcpywskbd_get_backlightusbd_reload_device_descsmsc_read_regaxen_newbufext2fs_advlockknote_fdcloseusbd_get_devcntif_clone_detachpipe_rfiltopsin6_cksumcomcninitstrncmpcsrc_ptevfs_shutdowngetsockieee80211_get_deauthbs_notimpl_bs_c_4upl_startzssp_matchsyn_cache_respondif_creategrouppxa2x0_gpio_set_diruvm_iosbcheckreservepreemptbioattachieee80211_begin_scanpriq_opsunixdomainsmdscsibusattachugl_devsnsgphy_cdulminwihap_data_inputpxa2x0_lcd_free_screenproc0paddrrn_addmaskure_read_memuvm_vnode_poolusb_attachbpf_bufsizeselscanpxa2x0_do_pendingsoo_polluvm_map_uaddr_esig_filtopsknote_processexitohci_device_bulk_transferukbd_cdzkbd_accessopspxaip_scwskbdopenpxa27x_fastbus_run_modettclosurl_rxeofipsec_soft_allocationssleep_setup_bus_dmamem_mapip6_fragmentnet_sysctlcom_cdusbf_devinfo_freewskbd_do_ioctlxscale_cache_cleanD_Euvm_pmr_size_RB_FINDudv_listdead_ioctlaue_initusb_match__wdccommand_startsdmmc_complete_xssysctl_iflistrasops_alloc_mattrvwakeupif_clonerswdcbit_bucketvgonewdc_probe_capspmap_initializedtcp6_ctlinputbpf_wakeup_cbsched_init_runqueuesusb_allocmemif_linkstatesd_sizeufsspec_closene2000devsnd6_prefix_offlinkuvm_anon_dropswapif_start_lockeddl10019_mii_bitbang_readwi_detachigmp_inputkmemusagezapm_suspendswcr_sesnumlf_getblockautoconf_attdet_mtxtcp_rttdfltcleanerprocieee80211_parse_edca_params_bodysbappendstreamm_tag_copy_chainohci_handoversowrite_filtopssr_chunks_unwindstrncpysdreadsys_pselectupdatefatscue_memata_perrorvfs_getvfssr_alloc_resourcesure_disable_teredoaue_txeofffs_sync_vnodedeflateInit2_sr_raid6_discipline_initproc_stoprrticks_initbio_status_initusbd_set_port_featuresysctl_lockax88190_mii_writereglockfpoolmq_dechainrasops_copycols_rotatedpledgereq_flagsmextfree_registerieee80211_find_nodecpu_switchtohtonlsched_all_cpusin6_mask2lentcp_dooptionsdos2unixtimesys_sigactionsr_scsi_donewsdisplay_suspend_devicedeupdatusb_fill_di_taskzapm_get_eventSHA256Transformrndlock__negdi2in6_purgeaddrcpu_modelieee80211_input_ba_flusharm_dcache_align_maskcttyreadcd9660_unlockuserconf_cmdsural_taskwsdisplaycloseiophy_statusschedclockbpfioctlpush_componentconfig_attachohci_alloc_sitdcue_rx_list_initzaurus_battery_life_c3000pxa2x0_bs_tagsubstrcmpdl10019_init_cardbmtphy_statususb_syncmemdisk_unbusysoisconnectedurlphydebugsdmmc_ccb_allocusb_block_freememVOP_PATHCONFumass_fixup_sonydk_mountrootassertwaitokscsi_minphyssdmmc_delayxscale_cpwaitvattr_nullsys_getsockoptufs_ihashuhidev_attachwsmouse_mt_initure_tx_list_initfrag6_nfragpacketspxapcic_pcmcia_functionsaxen_startsr_raid0_assemblevfs_sysctlcpu_get_controlVOP_READLINKbuf_mem_initumass_cbi_methodspxa2x0_intr_bootstrapnsphyter_funcsmii_submatchrasops_wronly_putcharohci_root_intr_transferwsdisplay_unset_cons_kbdmsdosfs_pathconfoldpidstimeout_wheelpxa2x0_setsoftintrarp_listumass_io_getaverunnablecd9660_getattrttyfreettysleeplcd_cduvm_pausedp8390_initzapm_bcintrunp_disposescsi_inquireufs_getattrBlowfish_encipherieee80211_mhz2ieeevfs_exportpxammc_scoop_capool_wait_gcsr_hotsparepoly1305_updateuvm_km_pgremoveex_region_plfscalesmsc_matchffs_alloccgblkpxaudc_disableip_optcopyvfs_registerscoop_mmc_matchieee80211_proto_attachsys_dupmcllowatmii_printieee80211_setup_ratescd9660vnode_filtopsbpfilterattachproc_stop_totimeout_todoswcr_initcpu_read_cache_configwsemul_vt100_scrollupzkbdsleeptvsr_ioctl_createraidpanicget_pc_str_offsetural_rxeofcue_rxeofL_cksumdataieee80211_channel_initmsdosfs_lockseltruewsdisplay_console_devicemq_enlistscsi_xs_syncsoftdep_initializeunp_shutdownsdmmc_mem_send_scrieee80211_tkip_encryptwi_resetdovutimensdummy_get_timecountext2fs_sysctlgeneric_bs_wm_4kthread_run_deferred_queuearc4_initpxa2x0_gpio_bootstrapwdreadlastdaycheck_execwi_usb_cdtcp_initsdmmc_start_xspcmcia_attachpte_l2_s_cache_mode_ptpool_request_initdeferred_config_queuedp8390_getmcafbuf_rb_bufs_RB_MINMAXipport_lastautowsmux_detach_sccom_raisedtrpxaudc_bus_methodsicsphy_statusip6_pcboptwinSlotCntvn_kqfilterext2fs_syncsched_stolenpte_l2_s_prot_maskudav_ioctlcrypto_registercache_purgevfszaurus_udc_activatepostsiguvm_mmapfilesys_pathconfcue_open_pipespxapcic_mem_allocin_addmultigetmicrotimebs_notimpl_bs_rm_8zssp_cdrasops_reconfigmaxthrsleepumass_clear_endpoint_stallwsmousekqfilterohci_setup_isocaue_newbufscsi_probedevaxe_ax88178_inittcp_templatewsmouse_positionmsdosfs_readohci_initcomopenusbd_setup_xferauth_hash_hmac_sha2_512_256afmapieee80211_tree_RB_MINMAXmtagpoolbcopywsmousecloseurl_tick_taskrtrefbufcache_releasesigcoderetcue_detachusbioctl_bus_dma_inrangekqueue_wakeuprasops_wronly_copyrowscpufunc_auxcontrolip6_unknown_optuaddr_rnd_removetcp_reasssys_getfhext2fs_vgetrt_timer_timercomcnputcKERNEL_BASE_physSHA1Update_intwsemul_vt100_output_scs94cuio_applySipHash_Endscoop_cageneric_bs_rr_1axe_resetlcd_get_backlightdefrouter_addreqin6_clearscopend6_dad_ns_inputuvmpd_tunertisvalidusbd_set_addressne2000_readmemscoop_cdudav_openpipesffs_setblockipsec_expire_acquirekue_stopwsscreen_switchwaiticmp6_mtudisc_cloneinflateResetmemcmpwskbd_init_keymapnamecache_rb_cache_RB_REMOVE_COLORip6_dad_pendingieee80211_rate2plcpmsdosfs_createcd9660_startzkbd_hingepte_l2_l_prot_uwcomstartaes_xts_reinitcfroots_sizetickadjip6_splithdruvm_map_addr_augmenttcp_secret_initieee80211_recv_sa_query_reqsbreserveundefined_initip6_sendvrecycleieee80211_alloc_nodeblf_ecb_decryptcrcopyural_newstatewdcloseundefined_handlerssys_revokeusbf_get_xfer_statusural_free_rx_listsysctl_stringsys_rebootpxammc_host_maxblklenuvm_unmap_kill_entryext2fs_specvopsbufpooldl10019_mii_bitbang_writeure_miibus_statchgproc_finish_waitwdccommandext_dist_code_bus_dmamap_load_buffersigonstackcpu_forkuaddr_kbootstrap_selectwi_write_data_ioscoop_checkdiskttylistwdopenuvm_vslocksigfilldeflateResetuvmfault_update_statscast5_setkeyttyoutputsr_raid5_wu_donekue_caexplicit_bzerousbf_cacd9660_tstamp_conv17wskbd_calxtphy_statustqphy_cdpxa2x0_wakeup_configcopyaddroutif_watchdog_taskpcmcia_scan_cispxa2x0_memctl_iohclockintrcpuset_add_allsystqmpVOP_READufs_ioctlffs_freefilein6ifa_ifpforlinklocallastdtimegetdisksys_setuid_wdc_ata_bio_startstart_updateudav_cdusbd_clear_port_featureusb_abort_task_threadufs_quota_free_blocks2senditsr_crypto_decryptbufq_fifo_destroylcd_bpp16_screensr_raid5_createusbf_add_endpointhidkbd_decodeuvm_setpagesizepxa2x0_lcd_list_fonttcp_xmit_timerrn_add_radix_masksr_raid1_rwin6_recoverscopensphy_serviceaue_tickpxa2x0_gpio_get_bittimeout_add_tvtickmclpool_warnmsgscsi_pending_finishscsi_preventmmclosecd9660_accesssr_wu_getffs_statfsscoop_set_sdmmc_powercpuset_complementrijndael_set_keywdcprobeiophy_cdudp_recvspacea4x_bs_w_1fdt_node_property_intkm_allocfdropsr_block_putgf_initsyn_cache_unreachuserconf_histszsys_getrlimiticmp6_errcountbpf_attachdicmp6_ctloutputieee80211_ba_move_windowstuck_keyscpuset_issetufs_dirremoveaxen_devsrgephy_servicepxagpio_reg_writeChacha20_Poly1305_Updateif_attachsetuppipe_writesr_set_chunk_staterasops_wronly_erasecolsuvm_map_addr_RB_FINDin_pcblookup_listensbappendm_copybackure_write_1wsmouse_input_syncif_idxmap_removepxammc_cdscsi_remove_linkuvm_swap_puticmpbmcastechoHMAC_SHA1_Initbufheadconfig_scanwi_get_nwkeypxa2x0_gpio_clear_bitkp_pageablesr_raid6_addiopmap_copy_page_funcpxa2x0_lcd_attach_subripsrciso_nchstatskue_txeofaxen_lock_miiural_amrr_startnlineswohci_rem_edether_ifattachinflateSync__wdccommand_donesdmmc_function_freeumass_adjust_transfersignal_initnsphyter_servicefill_drlistffs_updatewsmuxclosedp8390_getwsmouse_input_cleanupunix2dosfnspec_advlockmtdphy_cdmax1111_adc_valuefragtblraw_sendspacenullopzaurus_udc_is_hostsdmmc_intr_disableAES_CMAC_SetKeym_purgecomdiagextralocunsleepvop_generic_bmapwdprobescsi_xs_getmtdphy_funcsblf_encryptsched_proc_to_cpu_costohci_alloc_std_chainipintrpool_gc_schedgetnanouptimesdmmc_scsi_detachdes3_encryptmaxdmapural_alloc_rx_listusb_block_allocmemext2fs_symlinkip6_savecontroldevice_registerpxauart_activatebufcache_getanycleanbufsr_raid6_set_chunk_statend6_dad_stoptimertaskq_sys_mpq_to_bpte_l2_l_prot_krOF_getpropmountrootsdmmc_scansyn_cache_resetuhidev_openundefined_entryprocess_read_fpregsip_initreaddeohci_freexural_txtimecd9660_rrip_getnameufs_check_exportsysctl_rdintcd_interpret_sensein_mask2lenural_eeprom_readpxagpio_matchscsi_iopool_destroylodirtypagessr_ioctl_disciplinefindwin95VOP_WRITEsys_nanosleepusbf_free_bufferstart_init_execifq_start_taskifa_update_broadaddrnd6_addr_addifa_ifwithaddrclock_ymdhms_to_secsrootduidif_clone_attachsys_getfsstatohci_abort_xferbpfopencdstrategydeflatePrimegpt_get_fstyperefcnt_relerandomwrite_filtopsnd6_slowtimo_chuvm_km_valloc_alignenc_xform_nullpriq_deq_commitm_extfree_poolip6_pullexthdrcpu_idle_entercomwritebuf_kva_starttuagg_subVOP_RENAMEauth_hash_gmac_aes_128cdclosesys_fchdirsr_crypto_readsdmmc_scsi_cmdgreen_onprocess0niq_enlistpxapcic_mem_freearm_idcache_min_line_sizeieee80211_send_eapol_key_reqrandompidwd_cdurl_initusbf_open_pipe_ivalfilt_ttyrdetachsdmmc_mem_send_op_conduhidwrite_bus_dmamap_destroyvn_pollinet6swrouteswdosdirtemplatemainbus_cdpxa2x0_lcd_cnattachsys_mincorene2000_test_memapm_power_printieee80211_tree_RB_REMOVErasops8_putcharlastsecondswsmousedoopenwi_get_txpowerural_plcp_signaludav_stopusbd_error_strscdcef_caamphymatchscoop_set_headphonepxapcic_intrtcp_maxpersistidleOF_getpropintudav_tx_list_initspec_ioctlzkbd_set_ledsufs_initproc_reparenta4x_bs_r_4uvm_exitfc_bmapcallsffs_initsdmmc_submatchsr_crypto_createpxa2x0_gpio_clear_intrscsi_ioh_setbootsyncuvm_initcdcef_matchaue_attachieee80211_crypto_attachsys_ioctlusbf_clear_endpoint_featureuvm_map_addr_RB_NFINDif_free_sadlsdmmc_attachfilt_bpfrdetachwsdisplay_emul_caarpreplypxa2x0_clkman_configcompress2icmp6_initbs_notimpl_bs_rm_1uvm_mapent_free_insertfilt_ttywritepool_update_curpagehid_end_parsepxa2x0_gpio_intr_unmaskin_setsockaddrsrp_startupbpf_moveinwsemul_vt100_output_esc_spcostypevndbuf_pooluvm_page_physloadaxe_iffreset_entryuvm_pmr_remove_1strangewdcresetwdc_exec_xferip6_insert_jumbooptipintrqtuaggsr_raid5_intrusbf_add_stringusb_frag_freelistpxapcic_intr_disestabliship_slowtimordsizerijndaelKeySetupEncprocess_initializeip6_nexthdrrtdeletemsgpledge_swapctl__bss_startrtable_satoplenkue_rxeofrijndael128_encryptVOP_KQFILTERukphy_funcssys_msyncdeflate_compresswskbdreadsbappendrecordevcount_detachsd_capcmcia_function_disablesoftdep_fsync_mountdevinitmsgbufwsmouse_attachniq_initmemsetcuio_copydatapipe_free_kmempxa2x0_splxufs_getlbnsieee80211_get_actionphysiosr_ccb_donepcmcia_3cxem556_func0_cfe0in6_selecthlimupl_sendwdattachrootonlyportsmii_phy_delete_mediapxauart_attachin6_unlink_ifaicmp_mtudisc_cloneuvm_pmr_insert_sizesodisconnect_spllowersys_setgroupsmainaue_csr_write_2lxtphy971_funcsrasops_add_fontohci_device_bulk_doneether_crc32_le_updateifih_rcmtdphymatchmainbus_legacy_searchmsdosfs_bmaparrayukbd_apple_translatetimespecfixaxen_matchrasops_init_devcmapsr_raid1_set_chunk_stateural_set_basicratesip_flushieee80211_delete_keykue_startdp8390_configrasops_mapcharuvm_unmap_removepmap_alloc_l1amap_wiperange_chunkicmp_errorwsmuxdevsusbf_transfer_completepxagpio_attachbs_notimpl_bs_sm_1upl_rx_list_inituvm_swap_markbaddes_set_keykqueueopssmsc_miibus_statchgvholdzombiefindbufq_fifo_dequeueidgen32rt_if_removesr_minphysscsi_default_getghash_gfmulusbd_no_quirkm_adjsr_wu_donemld6_stop_listeninguao_shrinkpmap_map_chunkextent_alloc_subregion_with_descrppsratecheckkmemlimitbuf_rb_bufs_RB_PREVwsemul_local_translateamap_copybufq_drainphysical_endbio_statusuhidpollieee80211_ieee2mhzmq_initsched_wasidlesr_raid5_initieee80211_dup_bssuaddr_hint_destroylf_findoverlapsr_raid_start_stopmainbus_legacy_foundfilt_msdosfsvnodelf_wakelockkv_anykue_attachhookdumpconfAES_CMAC_Initwi_rxeofwsdisplay_cons_kbd_pollcdead_badopblf_cbc_decryptcalcrusys_unlinkin_scrubhostrt_setgatetcp_ack_on_pushpmap_growkernelext2fs_rmdirufs_chownrtmap_gcdofchmodatsysctl_intupl_tx_list_inituvm_shutdownkqueue_closewsdisplaystoppte_l2_s_cache_modeuvn_initstrlcatsysctl_int_arrbs_notimpl_bs_wm_8uvm_map_set_uaddrcdce_matchsoftintr_dispatchnd6_pooldisk_unlockufs_ihashremtaskq_destroycttywritegpt_chk_parts_bus_dmamap_createSHA256Inittcp_update_sndspacesr_crypto_doneurl_stop_tasksdmatchusb_freememudav_txeofproc0cdce_initfdt_translate_regufs_renameaxe_caext2gennumbersr_bio_ioctludav_attachuvm_map_entrybyaddrsr_already_assembledusbd_get_hid_descriptorrt_ifannouncemsgsoo_readwdc_scrub_xferscoop_resumeuvm_km_doputpageufs_opencopyout_statfspmap_modify_pvm_catsplxpxa2x0_rtc_setalarmtqphy_statuskp_dma_contigcd9660_isohashwi_write_data_usbumass_scsi_minphysuvm_swap_initpxagpio_intr0tcp_nowaue_miibus_statchgip6_hbhchcheckural_bbp_initunp_gcsys_clock_gettimeip6_hdrnestlimitcpuset_clearxscale_cache_syncI_rngfrag6_initbuf_replacevnodeure_txeofpte_l1_s_prot_kruvm_pmr_size_RB_NFINDure_read_1uvm_mapent_addr_removetimeout_setrdreadcrfromxucred__subdi3srp_get_lockedwsdisplay_resetntohsmsgbuf_putchar_bus_dmamem_freesd_flushcd_setvolext2fs_mkdirohci_openpte_l2_s_coherentext2fs_direntersys_symlinkatmii_pollstatrlphy_cawdgetdisklabelrw_exitkv_pagedupfdopenidgen32_initifmedia_list_addpidhashcdcef_encaprtprefpxaohci_detachxscale_context_switchuvm_totalencdebugugl_sendicmp6_ratelimitsr_raid1_createsys_mkdiratdl10019_mii_bitbang_opssdmmc_io_attachdofstatatstart_inituhub_attachether_fakeaddrsysctl_tc_hardwaresmsc_rxeofscsi_ioc_ata_cmdtcp_mssdfltpriq_enquvm_swap_freedata_abort_handlerusbf_setup_xferbs_notimpl_bs_r_1axe_initsr_block_getuhidev_set_reportin_pcbdetachmsdosfs_vfsopststohzaue_ifmedia_updcd_sizettycheckoutqicmp6_mtudisc_callback_registerne_pcmcia_detachvm_map_unlock_read_lnaue_causb_explore_tasksrnd_event_spacesr_concat_rwpmap_clear_referencert_getmetricswdc_ata_bio_kill_xferin6_ifdetachcn_tabswaplist_insertsmsc_lock_miiip_forwardsensors_taskqextent_createrdclosedisklistin6_lifaddr_ioctlsys_fstatfsurl_txeofkue_devsbs_notimpl_bs_sr_8m_injectip6_mforwardingffs_isfreeblocksrp_gc_finalizeseltrue_kqfilteruvm_map_lookup_entryaxen_cdicsphymatchBlowfish_expandstatebs_notimpl_bs_w_4dead_strategyswi_handleramap_populatewsevent_kqfilterusbf_new_devicespec_fsync__wdcwait_resetcom_pxaip_cadoacceptuvm_map_deallocateicmp_reflectieee80211_parse_wpazkbd_attachbpf_mbuf_ldbscsi_xsh_iohext2fs_reclaimwsmouse_input_initnd6_rs_output_set_timoffs_ballocsys_getgroupssr_raid5_xorieee80211_node_attachsys_linkatuhub_cdwi_start_usbgeneric_bs_wm_1ip6_raw_ctloutputkernel_textufs_startsigstkinitohci_devd__end__nsphy_reseturl_sendcdce_encapnd6_rs_timeout_countufs_bmaparrayfragtbl8uvn_sync_lockrtable_getpcmcia_function_enableaes_ctr_setkeyrasops_vcons_alloc_attrifq_barrierpledge_sendfdurl_resetp2p_rtrequesture_lock_miiusb_needs_exploreswaplist_findufs_quota_alloc_blocks2fc_fileextendsfilt_sigattachwsmouse_cdsdmmc_go_idle_stateVOP_FSYNCffs_sysctlipport_hilastautoarpinit_doneusb_wait_taskdoclockintruvm_anon_pageinspec_closecd9660_closeuvm_map_mkentrypxaost_cauvm_map_addr_RB_REMOVEsys_shutdowncngetczkbd_cdtc_adjfreqrnd_statesm_gethdrconfig_rootfoundcue_cdputcieee80211_phymode_namebufbackoffsysctl_rdstruct__divsi3uhidev_cdwsmousereadsr_raid1_initxscale_minidata_clean_sizeschedcpuurlphy_servicebpf_getsbappendcontrolukbd_set_ledswsdisplay_screenstatea4x_bs_rm_1softdep_flushfilesipv4_inputm_getclrpool_headax88190_mediastatuswsmuxioctlsr_crypto_read_key_diskapm_matchipforwardingieee80211_get_cts_to_selfohci_device_isoc_transferusbd_open_pipe_ivalicmp6_redirect_timeoutif_rxr_ioctlpxa2x0_wakeup_statussyn_cache_lookupaxen_miibus_readregprtactiveksym_upcaseufs_makeinoderasops_copyrowsscsi_xs_ioip6_process_hopoptsusbd_find_edescwsdisplay_set_cons_kbdfilt_ttyreadsys_getpgidcom_common_putcswaplist_trimcache_lookupaxen_detachrdioctlrijndaelKeySetupDecuvm_objtree_RB_INSERTsysctl_tcurl_detachbs_notimpl_bs_rr_1sdmmc_intr_disestablishumass_scsi_sense_cbsys_pledgedp8390_intrrijndael_encryptrasops_do_cursorwsemul_vt100_handle_dcsieee80211_recv_mgmtaxe_detachwskbd_set_console_displaydumpsizesowwakeupsdmmc_io_read_multi_1ukbd_keydesctabirda_onsr_raid_inquirysmsc_setmacaddressextent_freeuvm_aiodone_daemonaddupc_tasksched_syncusbd_clear_hub_featureext2fs_vopscomclosepcmcia_print_ciseephy_attachsetsigvecurl_iffsys_sendmsguhidopenvn_marktextbpf_mfiltercleancachestrcmpsys_quotactluhidev_matchieee80211_get_hdrlensr_raid_startwutcp_mtudisc_increasesdmmc_card_attachure_startulmaxin6_pcbconnectdehashkue_cduvm_pmemrange_addr_RB_INSERThook_disestablishexphy_funcsbpf_catchpacketffs_isblocksr_concat_createpxaip_cdzaurus_startusbd_find_quirkuvm_swap_allocpagesuvm_aobj_poolsys_adjfreqqsphy_funcsicmp6_reflectsetrunqueueudv_attachsettimecdce_rx_list_inituhub_intrarm_pcache_typertable_initdp8390_detachata_set_modemii_phy_auto_timeoutsyn_cache_getnetisrpxaudc_bulk_transferttyrubieee80211_get_ratevop_generic_islockedpxaudc_bulk_closeuaddr_hint_poolwsemul_vt100_output_stringwsscreen_attachm_pulldownbufcachepercentlcd_screen_listenc_xform_chacha20_poly1305pmap_initufs_rmdirrlphymatchieee80211_next_scanpmap_zero_page_funcarmv4_tlb_flushD_SEminsr_meta_native_writeip6_initconfig_detach_childrenrawcbsmsc_detachukbd_cngetcz_errmsgtcpcb_poolmii_bitbang_readregpxa2x0_cpuspeeduvm_map_addr_RB_INSERTBlowfish_stream2worduhidclosetimeout_add_msecipip_allowsys_polluvm_map_clip_endufs_makedirentryusbd_set_configuvm_mapent_mergeieee80211_recv_addba_reqm_defragrtable_l2setvnode_hold_listlastdosdateudav_unlock_miiscoop_timeoutbuf_rb_bufs_RB_NEXTufs_linksched_choosecpusys_mkfifozcallocure_write_2ural_read_eeprompcmcia_parse_cis_tuplein6_ifinitin6_leavegrouprtlabel_id2sasqphy_casddumpiminnet_tick_tosys_chflagsget_hw_ifidKQRELEdelaysdstartip6_hopopts_inputamap_chunk_getieee80211_media_initselfalsevt100_outputscsi_default_putsr_free_resourceswsemul_vt100_output_esc_percentcom_enable_debugportpage0_datavn_isunderusbd_get_port_statusuvm_pageoutpxa2x0_setiplpffindtypepdevnamesqsyncwi_setmultiuvn_clusterinitprocesscd9660_vptofhwi_attachusb_camii_phy_downraw_inituvmspace_forkknote_enqueuepoly1305_finishudpcksumtcp_sendspaceurl_csr_write_4dl10019_mii_writeregpop_symlinkml_dechainuvm_pmemrange_addr_RB_REMOVE_COLORffs_oldfscompatieee80211_add_rsnrijndael_decryptwdcdetachmaxlocksperuidin6_matchlensys_madviseupl_openpipesscsibusdetachdisk_attachwskbd_displayioctlip6_clearpktoptsncpusarptfreebufadjustcom_detachieee80211_ccmp_encryptaxe_stopural_set_macaddrbs_notimpl_bs_w_2dead_printohcixfereephy_serviceinphy_servicemii_media_tablesr_discipline_freewdstrategyttyprintfip_sendreaperprocsigcodeipip_inputdeflateCopyieee80211_send_group_msg2comttyne2000_detectbuf_undirtysysctl_tstringsr_meta_clearusbd_start_nextxscale_cache_cleanDrt_putgwroutefilt_ttywdetachamap_swap_offrt_setgwroutesys_sysarchallprocessBlowfish_decipherbio_validateigmp_initmii_phy_add_mediacpu_reset_needs_v4_MMU_disablecache_zapMD5Initcryptodesc_poolbus_space_write_raw_multi_2ffs_vfsopssysctl_mallocwihap_ioctlieee80211_outputlcd_burnerfrag6_slowtimouvm_pmr_insert_addruvm_map_hintwant_reschedpmap_bootstrap_pv_allocatorpxa2x0_gpio_intr_fixupieee80211_ioctlmsdosfs_mkdirkthread_create_deferreduhidevsubmatchrasops8_initcrc32_combinebufq_simple_nscanpxammc_intr_donedevid_freescsibusactivatend6_timercomcnpollcbpf_mbuf_ldwbioopenusbf_stall_pipeqsphy_servicepxaip_attachcd_patterns__cmpdi2ffs_checkrangesr_crypto_create_keyssd_ioctl_inquiryscsi_xsh_adduvm_pmemrange_addr_RB_FINDraw_detachscsi_xsh_runqueuepmap_get_pdeural_read_multiaxen_txeofbs_notimpl_bs_wr_1domainnamelenigmpctl_varsusbd_get_report_descriptorsd_thin_paramsfiledesc_initurl_ifmedia_statuscue_csr_read_1vrelewi_set_pmwsmux_do_displayioctlohci_alloc_sedpxa2x0_lcd_setup_consolescsi_xs_errorcheck_consoleapm_record_eventfdt_get_stramap_freend6_rs_dev_statein6_domifattachwsdisplay_cnputczapm_restartusb_blk_nfreend6_prefix_lookuptc_getfrequencyaxen_ticksync_inactivespec_printusbf_start_nextukbd_apple_mba_mungeext2fs_lookupmsdosfs_openext2fs_linkvop_generic_revokeohci_hash_add_itdnd6_resolveapm_activateieee80211_decapfilt_sigdetachfilt_seltruedetachext2fs_renameipsec_def_authsrp_gc_initusbd_setup_isoc_xferpxa2x0_bs_vaddrttywflushcd9660_rrip_offseturl_startwskbd_default_keyrepeat_datacomcnmodeclosefcomioctlumass_cbi_resetscsi_ioh_deqsoftdep_sync_metadataif_clone_lookupgetmicrouptimemii_tickpxa2x0_bus_dma_tagdisk_openpartip6_dad_countuvm_pager_dropclusterfilt_generic_detachpxa2x0_lcd_mmapip6_getmoptionsif_map_dtorsensor_task_unregisterzssp_ic_sendwdc_ioc_ata_cmdpcmcia_card_deactivatepxaudc_allocmpledge_ioctlwi_pcmcia_matchcd_get_parmszkbd_cngetcpmap_extractin_purgeaddrnd6_ifptomacwsmousedoioctlamap_unaddural_watchdogmsdosfsread_filtopswsmouse_ptr_ctrllcd_cnattachuvm_pmr_insertcd9660_printsr_meta_saveohci_rhsc_enableif_congestioncd9660_islockedin6if_do_dadcue_txeofaue_detachpipe_kqfilterdowait4ext2fs_openpmap_devmap_find_papmap_kenter_cacheusb_insert_transferaxe_matchrasops4_copycolsukbd_keymapdatasr_meta_validatestopprofclockbufq_nscan_destroynullioctlsys_getentropyrasops_getcharpte_l2_l_cache_modearm_dcache_min_line_sizeisohashmclsizesparsediskfilt_wseventdetachwi_set_debugzkbd_onsdmmc_mem_single_write_blockbreadieee80211_node_copynd6_rs_outputamap_lookupipctl_varswsdisplay_suspendpmap_page_removert_timer_remove_allwskbddevprintzkbd_irquhid_intrwdc_output_bytesieee80211_classifyzkbd_modstateaxen_ax88179_initwsdisplay_closescreenieee80211_media_statusproc_stop_sweepiophy_capmap_set_pt_cache_modescsi_xs_exectcp_usrreqmichael_keyieee80211_setbasicratessd_interpret_senseuvm_map_pageable_pgonuvm_addr_invokeudp_usrreqifmedia_initusbf_open_pipertable_l2ext2fs_vfsopsuvm_mapent_freeext2fs_inactivetcp_syn_cache_activedead_bmapif_getgroupmemberssoo_kqfilterml_enqueuecpu_startupusbd_set_hub_depthwsemul_vt100_output_dcs_dollaramap_refwdc_ioctlamphyattachapm_suspendsfdexpandtickscoredump_countsegs_elf32sr_wu_initwdc_ata_presentmsdosfs_closerd_detachpool_do_getext2fs_setattrapm_resumesysctl_clockratevn_rdwrohci_close_pipend6_need_cacheip6intrfdt_node_namesyncer_maskwdc_default_write_raw_multi_2if_ih_removeuvm_pagedeactivateearly_clkmanufs_unlocktcp_ctloutputure_initpxa2x0_turbo_modeukphy_statusnd6_listieee80211_derive_pmkidMD5Updatenumfilesblktochrifmedia_setscsi_iopool_puttask_setpcmcia_function_initbio_lookuppmap_createuvm_map_extractsr_crypto_meta_opt_handlernd6_prelist_addufs_removebpf_mbuf_ldhsysctl_tc_choiceptsignalboottimecd9660_readlinkwsdisplay_set_console_kbdxscale_cpu_sleepVOP_ADVLOCKaxe_watchdogwskbd_mux_closefrag6_inputcompressBoundpmap_alias_distunpst_sendspacewsemul_vt100_output_escffs_indirtruncsmsc_cdieee80211_add_ratessr_raid5_rebuildpxapcic_mem_mapuvmspace_freetcp_rscalettwakeupext2fs_inode_poolffs_ino_poolmii_phy_statusmsgwsdisplay_internal_ioctlcpufunc_domainsswapdrum_getsdpif_input_queueVOP_PRINTfdshareuipc_setaddrsdmmc_intr_taskugl_tx_list_initicmpv6ctl_varszaurus_udc_matchrasops_vcons_unpack_attrcdstartsdmmc_stimeoutgf_premulfilt_generic_readwriteuserconf_disablevrefusb_detachin_pcbaddrisavailohci_device_isoc_closeurl_int_miibus_writereguhidev_activatevt100_ansimodeAES_CMAC_Finalsr_uuid_formatrasops_lmaskure_write_4sd_cmd_rw16ghash_updateinpcb_pool_initializedsys_nosysat_pollsigfillsizallproccdevswsr_rebuildxscale_cache_flushDne2000_attacharpcachesys_mlockallusbf_config_endpointwskbdcloseuvm_sysctlstatintrgetsndiskmapopen_bus_dmamem_unmapsys_fchflagsnamei_poolpxa2x0_pi2c_readarp_poolsmsc_ifmedia_stszssp_caukphymatchpxa2x0_gpio_get_functionuvm_pager_putpledge_socketdiskmapcloseohci_device_bulk_abortudav_cain_canforwardrasops_unpack_attrieee80211_clean_cachedsmsc_unlock_miipxa2x0_bs_subregionohci_device_intr_abortieee80211_tree_RB_INSERTrasops_copycolswi_pcmcia_attachpmap_destroyip_oursscsi_mode_selectkernel_pt_listuvm_map_freelist_update_clearetherbroadcastaddrieee80211_rssadapt_updatestatscdcef_do_requestpte_l1_s_prot_urvfs_getnewfsiddiskstatslenaue_rxeofudp6_ctlinputitimerroundSHA512Finalaxen_miibus_writeregarm32_vector_inituvm_pmr_size_RB_PREVscsi_print_sensewskbd_update_layoutmmopenffs_inode_freeohci_device_intr_transferwdc_cdamphy_statusukbd_intrrtioctlkue_ctlpxaost_get_timecountscsi_xs_putuaddr_hint_functionsieee80211_tree_RB_INSERT_COLORprofprocswdc_free_xferip6_inputbuf_free_pagessleep_finish_signalicsphy_cdwi_usb_cmdrespsr_crypto_alloc_resourcesgeneric_armv4_bs_rm_2route_srcnet_tickbootduidspeedup_syncerigmp_sendpktif_setlladdrin_ioctlloop_clone_destroywdc_ata_bio_doneifmedia_baudrate_descriptionsv_putcsr_scsi_wu_getsdmmc_add_taskm_getptrukbd_caufsvnode_filtopsscoop_pcic_set_poweruvm_fault_unwireuserconf_common_attr_valsched_noidlesys_getitimerhid_get_datadonicewdcstartcpu_configuresr_rwip6_freemoptionssqphy_funcshidkbd_delayed_decodeieee80211_amrr_chooseusb_create_task_threadsieee80211_end_scancdce_txeofwsdisplay_common_attachne_pcmcia_matchbufhighpageswsfont_rotate_internalpmap_fault_fixupuaddr_poolrn_refinesgeneric_bs_rm_4hmac_opad_buffersockargshidkbd_ioctlwsdisplay_getactivescreenvop_generic_abortopsr_raid6_set_vol_statesetregsupl_rxeofsobindvmcmd_map_zerozkbd_pollpxagpio_intr1m_getuioml_enlistvfsinitupl_cacnclosetcp_do_rfc1323ip_fragsin_addhostifq_deq_rollbackwdc_dmawaitmii_phy_setmediakd_trylockhostidwi_alloc_nicmem_usbusbd_free_bufferuvm_pagermapoutsr_raid0_rwif_downallsys_kbindext2fs_vptofhnam2blkrw_statussr_raid6_assemblecoredump_writeseghdrs_elf32rt6_deleterouteip_maxqueuesysctl_ttyieee80211_chan2ieeeuhub_cazssp_initin_socktrimieee80211_recv_delbaext2fs_dinode_poolieee80211_node_cmprtallocsys_mprotectieee80211_std_rateset_11gwi_pcmcia_cadequeue_randomnessuvm_km_kmemalloc_plafilt_cd9660vnodecue_casyncer_maxdelaywsdisplay_getscreendeadprocstart_reaperif_rxr_info_ioctlunicode_to_latin2sys_fcntlvfs_free_addrlistsys_setrlimitsys_sigpendingwsmouse_evq_putloop_clone_creatediskmapwriteure_ifmedia_stsuvm_map_cleanuvm_pmr_get1pageicmp_redirtimeoutttyclosewdrestartzapm_charge_completepxa2x0_lcd_ioctlusbf_freememcomp_algo_deflatemaxvfsconfml_dequeuetimeout_addcpu_cdip6_forwardbufcache_adjustwskbd_set_backlightnumcachepxaudc_write_epNsr_bootkeyural_write_multitcp_syn_use_limituvm_pagecountcpu_initclockscue_sendwskbdioctlmii_downcdcef_attachin_pcbhashbrelseext2fs_unmountpsratiosdminphysohci_device_isoc_methodswi_usb_tx_lock_tryaxe_unlock_miicpuset_delwsdisplay_switch3nd6_rs_output_timouvm_mapent_sharettyoutdevice_lookupwdc_pcmcia_prbpf_sysctl_lockedwi_usb_txeofsr_crypto_preparecdcef_start_timeoutcdminphysschedhzurlphy_carip6_inputtcp_totbackoffvdropuserconf_basesdmmc_mem_sd_initsr_raid5_rwlooutputcue_setmultisoisdisconnectedpxa2x0_bs_barrierxscale_cache_clean_addrif_putrevbitsdvd_read_disckeypmap_clean_pageuvm_aio_aiodonesr_ccb_rwpmap_clearbitieee80211_mgmt_outputcrypto_freereqsyn_cache_rmclrbitsuvn_putigmp_checktimerscsi_add_linkxscale_cache_clean_minidataieee80211_proto_detachpool_gc_pagesmii_phy_statuspcmcia_card_intrcommajordl10019_mii_resetrasops_list_fontcrypto_newsessiongeneric_armv4_bs_r_2pxaic_baseenc_xform_aes_xtssoclosesr_ccb_freescsi_detach_targetinstall_coproc_handler_staticwakeup_nsys_connectbuf_daemoncrsetskpcsdmmc_scsi_attachpxammc_bus_clockpxammc_bus_powerchacha20_reinitieee80211_bip_decapbufq_fifo_createohci_root_ctrl_transferipv6ctl_varsroute6_inputbs_notimpl_bs_w_8cdcef_stopcsr1board_startupsys_socketpaircnreaddounmountuvm_swap_allockthread_create_nowwskbd_pickfreehidkbd_bell_fn_argtcp_ackdrop_ppslim_countusbf_cdarm_picache_sizesr_map_rootttspeedtabkqueue_readOF_getnodebynamecd9660_mountintr_barrieruserconf_maxdevcue_inituvm_pmemrange_addr_RB_INSERT_COLORfork_tfmratelxtphymatchsr_hotplug_registerpv_sizensgphymatchzkbdhalttvuvn_sync_qin_proto_cksum_outwskbd_activatewsdisplay_cons_pollmodewi_media_statusurl_miibus_statchgnd6_purgeaxen_unlock_miitcp_keepidleif_attachheadnextcwi_scan_timeoutuvm_wakeup_plaiszerodevpxaudc_matchOF_getnodebyphandlefdt_next_nodeauth_hash_hmac_ripemd_160_96umass_cageneric_bs_sr_4ifq_destroylf_freesys_fhstatnullmodemohci_hash_find_itdsys___get_tcbieee80211_amrr_node_initraw_recvspacediskerrwi_startcd_cdwsdisplay_screentype_pickwsdisplay_addscreen_printpxaudc_openin6_pcbselsrcieee80211_state_namesys_preadne_pcmcia_activatescsi_movewdc_pcmcia_detachkernel_pt_lookupkmem_mapcd9660_check_exportukbd_translateconfig_pending_decrqsphyattachaxe_startieee80211_input_print_tasksoqinsquediskstatscdce_attachudp_inputnchrtoblktblihashrn_search_mifq_congestionresettodrusbd_ref_decrufs_readdirsys_flockpvwi_usb_do_transmit_syncspec_badopmsdosfs_linkbufq_nscan_dequeuebs_notimpl_bs_c_1ohci_root_intr_methodssdmmc_check_cis_quirksicmpctl_varsigmpstatsuspend_randomnessmichael_finalvn_initialize_syncerdpipeselwakeupxscale_controlcd9660_quotactlsr_rebuild_starticmp_sendadjtimedeltacdce_watchdograsops_vcons_erasecolspxagpio_intrNusbf_abort_pipewdc_ata_errieee80211_choose_rsnparamstime_uptimevm_min_kernel_addressuvm_pagealloc_pgcdce_intrsmsc_rx_list_initfilt_uhidreaduvn_wlistuvm_pmemrange_addr_RB_REMOVEsowakeupinsidetcp_autorcvbuf_incbufq_queuepxapcic_create_event_threadpxa2x0_lcd_stop_dmabs_notimpl_bs_r_4prefetch_abort_entrysigactsunsharetimeout_hardclock_updaterdattach_edataupl_detachrijndael128_decryptttkqfilterm_tag_deletecd9660_ihashremsensor_findip_fragmentfilt_timersys_getlogin59sys_statfsSHA1Finalsensordev_deinstallsched_nomigrationsinittimecountersys_sendsyslograwin6pcbtablepmap_protectkprintfdevice_unrefrc4_keysetupscsi_startuvm_pmr_addr_RB_REMOVE_COLORin_cksumvnode_poolzombprocessure_write_memuao_shrink_convertvnode_free_listtcp_savetiusbf_matchuvm_pagereallocapm_battlowsensordev_countuvm_fault_unwire_lockedklist_invalidateuvm_km_createthread_enddes_check_keyrt_senddesyncsogetopthid_report_sizeusbf_endpoint_attributesuvm_unmaprd_matchure_attachusbd_ref_waitsr_crypto_calculate_check_hmac_sha1wsemul_vt100_attachpollscandomaininitvflushbuftime_secondwskbd_get_mapentryuvm_pmr_initrt_matchsr_hotspare_rebuild_callbacksbcreatecontrolsys_mlockpxa2x0_maxspeedieee80211_setup_nodebioioctldvd_read_structvdevgonehtonsskip_propsbucketkqueue_writesys_syncfdt_child_nodeieee80211_reset_scancominitaxen_resetenodevsr_raid0_discipline_initffs_mountfsin_delayed_cksumwsemul_vt100_edrtstatttvtimeoutkd_waitokabtstacktimingsafe_bcmpspeclisthbdwritecpu_idle_cycleversion_to_spcVOP_INACTIVEsdmmc_io_read_4zkbd_cawsmux_do_closepte_l1_c_protouvm_mapent_biastcp_syn_cachemainbus_attach_nodernd_event_idxwsemul_vt100_translatehalteephy_cainphy_caure_read_4ieee80211_std_rateset_11aaf2idx_maxkputcharbootargssys_getsidRMD160Initdisk_gonewi_write_record_usbcue_csr_read_2wdc_pcmcia_disk_device_interfacem_trailingspacefileheadrc4_cryptusbd_alloc_xferscoop_mmc_get_ocrpxaudc_ctrl_abortnextvnodeidcttypollsr_meta_initural_startrotatedfontskp_dma_zerosensor_task_ticksys_swapctlpxaohci_matchcpufunc_dfsrpxammc_attachbd_reqpxa2x0_probe_sdramrasops4_initbs_notimpl_bs_rm_2copypktoptsrn_add_dupedkeymsgscpu_exitzapm_batt_lifeip6_initpktoptsuvn_getwsmux_add_muxunp_attachohci_device_isoc_starttcp_syn_bucket_limitsys_renamesr_raid6_xorqfrag6_nfragsip6_log_timeeephy_statusinphy_statusxscale_cache_purgeDscsi_activate_targetuvm_km_valloc_waitufs_ihashinitunp_defersys_sigreturnlid_suspendsbflushscsi_link_closeipsec_require_pfsswapdevwd_cawsdisplayttykue_sendsr_raid5_openingsaxe_tick_taskvn_readnclrunegheadbwriteleavepgrpqsphy_cdarmv4_tlb_flushDkernel_pt_tablepmap_get_pde_pteuvmpageropsuvm_page_initohci_root_intr_closewsdisplay_common_detachsr_copy_internal_datacast5_decryptsdmmc_io_xchgxscale_setupnamecache_rb_cache_RB_INSERTpool_multi_free_niwsfont_locktcp_timer_funcsipqent_poolure_capxaip_attach_criticalif_attachdomainbpf_d_rcicmp_ratelimitieee80211_rssadapt_raise_ratesr_crypto_decrypt_keyusbf_iface_endpointuvm_km_page_initrttimer_pooladler32_combineieee80211_regdomain2flagadd_entropy_wordsax88190_mii_readregrgephy_load_dspcodepxa2x0_gpio_set_bitsosenduuid_enc_letaskq_initdosetrlimitpxa2x0_pi2c_getvoltageuvm_pmemrange_addr_RB_PREVrn_initpledge_namei_wlpathuvm_objtree_RB_NEXTsr_scsi_probeloopattachdp8390_watchdogural_rxrateieee80211_save_iewdc_input_bytesusb_abort_task_thread_procRMD160Finalscsi_cmd_rw_decodeprocess_read_regschainlengthusb_fill_udc_taskpte_l1_s_prot_masksys_unlinkatural_disable_rf_tunettwakeupwrrn_lookupthrsleep_unlocksr_wu_release_ccbsrtmask_poolsmsc_write_reguserconf_show_attrsys_execvesdmmc_mem_send_cxd_datafdallocwsdisplayreadprfindin_hasmultiscsi_donechkvnlockhw_sysctltc_ticktockphtree_RB_MINMAXpxaudc_freexpmap_alloc_l2_buckettcp_syn_cache_limitnumvnodeszkbd_activatecomreaduvm_pagefreebpf_mem_ldbext2fs_inode_allocswcr_encdecwsdisplay_switch2scoop_check_mcrbufq_fifo_queueif_idxmap_initicmp_do_exthdrreapercoredumpfilt_kqueuemalloc_roundupusbd_strpxaudc_bulk_donepipe_readpxa2x0_bs_freeuvm_map_addr_RB_INSERT_COLORifioctlsys_utimesusbd_do_requestusbf_endpoint_addressrip_initsocreatepriq_allocusbd_find_idescpmap_cache_statemq_enqueueureadcaue_startufs_setattrrijndael128_setkeyieee80211com_headlogprimemhookzapm_batt_voltnd6_rs_initcast5_encryptsys_exitsbtrym_applyaxen_ifmedia_updxscale_maxspeedswcr_processudav_startaxe_lock_miiwdc_exec_commandpxaohci_caudv_lockbufqspxaudc_bulk_abortwdcintrcd_playHMAC_MD5_Updatesys_clock_getressdmmc_set_bus_widthaxe_attachsyn_cache_insertnsgphy_funcsrc4_getbytesswcr_authencttystats_initne_cdnd6_umaxtriesohci_device_intr_donedochflagsatusbf_get_stringpcmcia_intr_stringpte_l2_s_prot_kwnd6_debugip6_maxdynroutesuvm_map_piewindow_deflatein_prefixlen2maskcpu_cpuspeedcpufunc_iddefrtrlist_updateurl_csr_write_1_tr_initSHA1Transformesymusbf_schedsoftintrscoop_mmc_set_powercrypto_invokeieee80211_defragosreleasesdmmc_free_ccbsVOP_RECLAIMscsi_probe_targetsr_raid1_set_vol_stateip6_getpcboptbuf_releasewsmux_evsrc_set_displayHMAC_MD5_Init__modsi3smsc_txeoftcpqe_poolpgrp0url_watchdogbuf_flip_dmauserconf_changepxa2x0_lcd_new_screencrypto_taskq_mpsafeuserconf_helpsr_ioctl_setstateufs_advlockicmp_initarpinqpcmcia_cis_read_1cdst_pteuvm_growinet_ntopvfinddevieee80211_node_cleanupugl_attachrt_msg1apm_handle_eventether_delmultirefcnt_takesave_rtesr_crypto_get_kdffdt_is_compatiblearc4_taskexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutwdccommandshortwsevent_filtopsieee80211_rate2mediavcleanif_map_gciophy_servicecd_getvolsplassert_ctlsys_getresuidsys_fhopensr_crypto_ioctlzapm_battchkratedos2unixfnscsibussubmatchrtentry_poolbufq_restartzkbd_consopsuvm_km_pgremove_intrsafeext2fs_sbupdateure_rxeofin6_init_address_ltimesdefrtrlist_delsdmmc_mem_set_blocklensys_fchmoduvm_unmap_detachieee80211_recv_authupl_initusb_dev_quirkswskbd_srcopsdopselectuserconf_common_devpxa2x0_irq_handlerstartniq_enqueueusbd_devinfouvm_mapanonip6id_randomidvn_isdisksys_selectscoop_charge_batterydeflateParamsin_pcbpickportbadaddr_read_1vop_generic_lookuppxammc_functionsin6addr_intfacelocal_allnodeslogreaddead_lockieee80211_name2regdomaintcp_issphysical_freestartfc_largedistancemainbus_dma_tagsys_setitimerisofntransurl_attachnd_prefixsmsc_tx_list_initwsemul_vt100_resetvfs_unregistermii_phy_flowstatussmsc_ifmedia_upddisk_mapvt100_setnrcselwakeupffs_reloadifq_serializecnwriteumass_bbb_get_max_lunzkbd_keymapdatain_ouraddrpolloutuipc_usrreqnd6_na_inputrtl80x9_mediastatusvflush_vnodewsmouse_activateaes_key_unwraprip6_usrreqin6mask96coldpxaudc_ctrl_donecdcef_startunp_scansbappendaddrbufqs_mtxbpf_maxbufsizeextract_entropyufs_islockedusb_detach_wakeupffs_unmountne2000_detachffs_vopsdofutimenssys_pwriteisohashtblscoop_pcic_matchwihap_shutdownuvmspace_allocigmp_input_ifrevarpinputbufq_nscan_peeksdmmc_function_alloccd_pausecompresshashinitttstartumass_setup_transferwdwriteipsec_keep_invaliduao_detach_lockedpool_allocator_singlepledge_fcntlieee80211_parse_rsn_akmsdopentcp_tracemii_phy_resetip_getmoptionsdp8390_mediastatusin6mask32__moddi3rasops_doswitchdisk_countohci_confdpmap_page_protectdead_openscsi_detach_lunsr_ioctl_inqkue_setworddodup3userconf_attrwdc_kill_pendingrt_getllbmtphymatchicmp6_redirect_outputifq_restart_taskroute_cbsys_futimenstaskq_createexphy_cdreadepcpuset_init_cpuscsi_init_inquirylxtphy_resettcp_slowtimoieee80211_std_rateset_11bamphy_cdcd_play_msfpmap_remove_pvtcp_newtcpcbsbchecklowmemswapmountffs_mapsearch_bpf_mtapsys_fhstatfself32_load_filesys_getpeernamepxapcic_io_mapuvm_amap_chunk_poolieee80211_setup_htcapsieee80211_get_txkeyscsi_strvistcp_set_iss_tsmbpfwritedoingcachesys_getrusagescsi_probeapm_threadrasops_initauth_hash_hmac_sha2_256_128aue_reset_pegasus_IIuvm_map_addr_RB_MINMAXbufq_destroywsmouse_mt_updateusbd_get_cdescnd6_prunecomconscflagm_getffs_truncateuhidevprintmii_attachsdmmc_cdttylcloseconsbufppool_allocator_allocwdc_default_read_regchar_typeohci_free_sitdusbctlprintvn_closeudav_csr_writeuhid_do_readrt_timer_queue_countcdcef_initusbd_close_pipeusbd_deactivatewsdisplay_cfg_ioctlffs_writeieee80211_wep_set_keyfilt_sowdetachnd6_initip6_maxfragsm_extref_mtxlimfreedoutimensat__wdccommand_intruvm_km_free_wakeuprootvnodeifmedia_ioctlpxammc_host_ocruserconf_modifyusbf_setup_pipewi_usb_rxeof__one_cmpldi2spoofgptlabelcpufunc_nullopcd9660_ihashgetmii_phy_detachwskbd_add_mux__muldi3uhidev_caurl_lock_miiip_mtudisc_timeoutrandomopenin6addr_linklocal_allnodesamphy_caure_miibus_readregpxaudc_attachusbf_allocmembufinitbootconfigscsi_quirk_patternsuserconf_lineslimit0uvm_md_constraintsif_attach_commonlcd_set_backlightpxa2x0_pi2c_openuniqdosnamesr_raid5_set_vol_stateinflateSetDictionarypfxrtr_lookupext2fs_mknodvttoif_tabwdc_pcmcia_activatebgetvppgrp_poolsr_concat_assemblesmsc_ioctlsd_cmd_rw12pledge_sendituvm_pmr_addr_RB_INSERT_COLORduid_iszeroucred_poolxscale_cache_purgeD_rngcpufunc_ifsrip_insertoptionsdes3_setkeyarp_maxtriespmap_uareacd9660_bmapax88190_mii_bitbang_writeaue_eeprom_getwordukbd_cnbellphtree_RB_INSERTnaptimeufs_dirbadentryusbf_close_piperasops4_erasecolslogioctlicsphy_funcsgeneric_bs_wr_1_bus_dmamap_load_uioetheranyaddr_bpf_filterstrlensensor_task_workinitialvnodesrasops15_putcharure_ocp_reg_writepriq_purgefilt_cd9660writeconfig_suspendzkbd_enablewsfont_initieee80211_parse_rsn_cipherwsdisplayparampool_page_freewdactivatecopystrsched_nmigrationswdc_do_resetsys_pipeural_setup_tx_descusb_detach_waitpxapcic_printpxa27x_run_modearm_pdcache_waysieee80211_encryptarp_rtrequesthw_vendorxscale_setup_minidataext2fs_reload_vnodeelf32_check_brandwi_cor_resetudp_initieee80211_recv_4way_msg3proc_trampolinepxaudc_read_ep0sys_rmdirdp8390_disablefilt_cd9660readcd9660_vfsopscpuset_copycdcef_methodsspec_accesssocantsendmorepxaintc_causb_rem_taskpte_l2_l_cache_maskcdactivateether_inputuvm_vsunlock_splraisequotaoffpxa2x0_read_ccntcoredump_note_elf32fs_posix_sysctlif_slowtimosmsc_tickudbtablewi_setdefwdcattachufs_printfatentrypledge_dropwpathswi_update_statschacha20_cryptAES_CMAC_Updateusbd_printBCDsys_statukbd_apple_mungein_baddynamicieee80211_keyrunlineswpxaost_cdmsdosfs_symlinksys_symlinkicmp6_sysctlpool_p_insertclfreeconfig_found_smuhidread_filtopsusbd_interface2endpoint_descriptorfdreleaseuvm_swapout_threadsural_bbp_writetask_addusbf_add_interfaceknote_attachlcd_activateieee80211_tkip_decryptdp8390_ioctl__assertwsdisplay_emul_matchnd6_dad_ns_outputin6_prefixlen2maskscoop_akin_pulluppcmcia_megahertz_xjem1144_func0_cfe0uvm_pmemrange_use_insertudp6_outputieee80211_prfcn_devvpcom_activatewi_get_debugmaxfilesupl_devsuvm_pagecmpuvm_pageactivatein6_addr2scopeidgf_mapdma_alloc_bus_dmamap_load_rawif_ih_refffs_mountrootrd_cdrrw_statuspxaudc_write_ep0uvm_map_pageable_allsleep_finishipqtaskq_next_workdl10019_media_initpxa2x0_lcd_show_screenrn_fixup_nodesmsdosfs_strategycd9660_vopstimeout_delif_rtrequest_dummyural_media_changewsemul_vt100_elieee80211_chan2modeif_delgroupspec_strategyuvm_pglistfreeusbopenax88190_media_initext2fs_readsoo_statwskbd_cnpollckue_newbufuvm_map_isavailrusage_pooldisk_detachtask_delstrchrsystqscsi_plug_poolrgephy_causbf_host_resetnd6_allocateduvm_pmemrange_use_cmpaes_xts_encryptuvm_pmr_size_RB_INSERT_COLORauth_hash_gmac_aes_256crypto_driverssysctl_int_loweriftovt_tabtcp_backoffsys_chrootieee80211_rssadapt_lower_rateicmp6_redirtimeoutsoisconnectingarc4random_bufwsmouse_set_paramwsdisplay_pollcsr_wu_freeaobj_pagerlo0ifidxzaurus_battery_c3000uvn_iogeneric_armv4_bs_w_2MD5Transformmld6_inputgeneric_armv4_bs_sr_2rgephy_mii_phy_autoieee80211_rx_ba_timeoutbpf_d_listsr_wu_allocsyn_cache_cleanupip_pcboptsfc_purge__data_startpxapcic_mem_unmapfilt_timerattachifmedia_delete_instanceurl_caenc_xform_aes_gcmuvm_mapent_allocudav_miibus_writeregacphymatchicmp6statzssp_write_lz9jg18generic_bs_w_4inflateEndbufcache_takesr_set_vol_statewsevent_pollsys_profilvmcmd_map_pagedvnugl_stopin6_pcbhashlookupwsdisplay_cdbpf_detachdVOP_UNLOCKpmap_uncache_pagesingle_thread_setsyn_cache_initieee80211_find_txnodecd9660_wchar2charip_ecn_egressether_ipmulticast_maxsr_raid6_createohci_checkrevuvm_init_limitsukphy_cdentropy_input_rotateusbf_softintr_establishin_pcbconnectVOP_POLLVOP_IOCTLbpf_mem_ldhsafepriunicode_to_latin7pxapcic_io_unmapuhidev_ioctlpxaohci_disablewdc_default_read_raw_multi_4ip6_copyexthdruao_swap_offmachinewi_cmd_ioVOP_CLOSEuvm_anallocin_pcbdisconnectzts_sync_ads784xuvm_vnp_terminatewi_usb_rxfrmsdmmc_io_read_1sys_getpiduaddr_rnd_functionsipmultipathunp_dropugl_matchuvm_map_advicetcp_mtudisctimeout_startupcue_matchrn_addroutesdactivatefilt_msdosfsdetachure_ioctlural_detachaxe_ax88772b_nodeidukbd_cnpollcdoreadlinkatdvd_read_manufactundstackconfig_activate_childrenure_read_2pxaip_printip6_check_rh0hdrieee80211_input_printdomkdiratremrunqueuesdmmc_be512_to_bitfield512usb_fill_udf_tasksoo_closetcp_recvspaceuvm_meteruhidev_maxrepiduvm_small_amap_poolpmap_needs_pte_synctcp_ackdrop_ppslimmaxthreadnd6_lookupin_insert_prefixieee80211_cache_sizescsi_iopool_runurl_openpipesukbd_countrylayoutzts_matchsys_getppidsr_raid_request_sensescsi_ioh_pendingmii_anaruaddr_rnd_selectrc4_skipVOP_READDIRdomainssdmmc_select_cardsd_cmd_rw6arm32_dma_range_intersectin4_cksumextent_alloc_subregionneedbufferwsemul_pickieee80211_get_addba_reqin6_ifattachtcp_rst_ppslim_lasticsphy_cawsdisplaystartbs_notimpl_bs_rr_4wsmouse_srcopsSipHash_Initohci_root_intr_doneip6_multipathusbd_get_device_descriptorpxapcic_submatchcd9660_initumass_fixup_yedataipsec_soft_bytesmichael_initnselcollemul_elf32usbd_open_pipeohci_softintrmsdosfs_lookupspec_pathconfhook_establishtcptv_keep_initsys_chdirext2fs_diremptysys_thrkilluserconf_cntext2fs_inode_freepxaip_capcmcia_ccr_writeapm_cdscsi_io_get_donexscale_cache_clean_sizebuf_objectpxaintc_cduao_grow_convertusbd_desc_iter_initsbcompresspmap_free_l1SHA512Lastcdevsw_lookuplogsoftcsys_adjtimerijndael_set_key_enc_onlyohci_device_clear_togglearm_icache_min_line_sizesr_ccb_allocwdstartwsmuxreadamap_splitrefspec_open_clonewskbd_do_opensoftnettqsd_thin_pagesnclruheadscsi_move_doneural_next_scanrasops_alloc_cattruvm_aio_biodonern_initheadusbd_get_descvop_generic_unlockrt_timer_adduvmspace_shareentropy_poolieee80211_print_essidroute_usrreqdeextendspec_vopspxapcic_event_threadieee80211_wep_encryptsr_raid6_openingsieee80211_recv_deauthsched_init_cpurasops_erasecolstcp_dropicmpstatudpctl_varsuvmpd_scanm_prependsys_getrtablesoftraid_casmsc_resetwsemul_vt100_output_scs96_percentinflateInit2_cd9660_pathconfax88190_stop_cardin_pcbrehashsyncer_delaynoresolvpathin_arpinputzts_scalezts_caufs_accessin6_embedscopeif_alloc_sadlphpoolunix2winfnmsleepsdmmc_io_resetwsfont_unlockreassignbufip_freemoptionssr_meta_rwnd6_invalidateieee80211_release_nodesohasoutofbandbs_notimpl_bs_c_2nd6_dad_duplicated_bus_dmamap_unloadieee80211_free_allnodesmsdosfs_fhtovppte_l1_s_coherentbs_notimpl_bs_wr_4OF_getpropintarraymaxvnodesether_crc32_beinflateBackEndieee80211_add_ssidcpu_reset_address__explicit_bzero_hookpgfindsoftint_pendingtcp_ackdrop_ppslim_lastloadfirmwarerasops_cmapswcr_compdecip4_inputtcp_inputsysctl_dumpentryrtrequest_deletedkcksumwsdisplay_cnattachnd6_gctimerieee80211_ccmp_decrypturl_csr_write_2iptimerip_inputwi_set_txpoweraxe_ifmedia_updwdc_ata_ctrl_intrusbd_get_endpoint_descriptor_tr_tallyudp_ctlinputmii_detachsdmmc_io_send_op_condudav_rx_list_initpool_sethardlimitrasops4_do_cursorip_freefsys_sysctlvfs_lookupwdc_default_write_regrlphy_statuscpu_info_listicmp6_mtudisc_updatesun_nonamekmeminitnsphyterattachnd6_ns_inputdeflateEnddevice_refffs_syncrd_root_imageusbf_task_threaduvm_map_submapsr_hotplug_callbackscnioctlsys___tforksr_ccb_getpool_primesdmmc_mem_scannsgphyattachdevid_allocm_extrefpgrphashtbldoppollifmedia_matchget_crc_tablestatclockwi_read_data_usbdvd_read_physicalrw_enter_writeuserconf_argbufure_cdpxa2x0_lcd_consoleMD5Update_intm_tag_copyinflate_tablepmap_l2ptp_ctorreaddisksectordata_abort_entryhid_get_itemrt_xaddrsmsdosfs_getattrip6_maxifdefroutersm_devgetwritedisklabelin_ifdetachmsdosfs_printkernel_pmap_storewsemul_vt100_opsin6_ifattach_loopbackstartprofclockohci_device_isoc_enternsphymatchupl_ioctlpte_l2_l_prot_kwundefinedinstruction_bouncesys_getresgidprocinitapm_userstandbysmsdosfs_readdirdead_ebadfextent_do_allocnd6_timer_taskpxaudc_enablewddetachsoo_ioctlswap_officmp_redirect_timeoutduid_equalforkstatwi_card_identaue_miibus_writeregnet_ticksdl10019_mii_statchgicsphy_servicenull_setkeywi_send_packetigmp_sysctlin6mask64ohci_rhsc_ableure_encapifq_attachsoftclockieee80211_node_freetc_initupdate_modifierffs1_compat_writeieee80211_amsdu_decapblf_decryptswdevtdisk_lockscoop_pcic_readarc4random_uniformsbwaitufs_reclaimkv_intrsafedorefreshcredsscsi_xsh_set_tr_alignsr_meta_opt_handlersdwriteohci_device_intr_startxscale_minidata_clean_addrlcd_accessopswsmouse_cafilt_logreadsysctl_rdquada4x_bs_w_4uvm_vnp_setsizea4x_bs_rm_2Chacha20_Poly1305_Initvmcmdset_extendural_caaes_key_wrap_set_key_wrap_onlyzapm_batt_stateip6_use_deprecateduserconf_hist_intextent_alloc_regionsys_mknodpmap_proc_iflushext2fs_mountfskill_vmcmdsuhid_attachrasops_vcons_putcharwsmouse_set_modezkbd_matchufs_mknodsbinsertoobOF_finddevicein_lifaddr_ioctlknotelf_advlockpffinddomainsdmmc_ccb_freeeephy_resetwsmux_do_openfreeifq_is_serializeddorenameatwi_ioctlzts_disablelcd_attachffs_hashallocpxa2x0_ccnt_enableswstrategyuserconf_pnumscsibusprintnamecache_rb_cache_RB_NEXTrtl80x9_init_cardwsmuxkqfiltermbstatmtxsys_getpgrpukbd_ioctlusbf_add_config_descwsemul_vt100_console_emuldatabpf_putsonewconnufs_direnterudav_csr_write1uhid_detachgeneric_armv4_bs_c_2pffindprotoudav_watchdogbold8x16_iso1uvm_pageallocsdmmc_io_enabletcp_saveti6wdctimeoutwsemul_vt100_initHMAC_SHA256_Updatenchrdevfrag6_freefundefinedinstructionuvm_pmr_use_incaue_cdnamecache_rb_cache_RB_INSERT_COLORuvm_map_vmspace_updateqsphy_ca